1. I am neither American nor Romanian. I read Chechar, but I don’t comment there. And I agree with you that his obsession with “Hellstorm” and Solzhenitsyn is unhealthy. In the big picture, human suffering is irrelevant so I am anti-humanist. My favorite philosophy is daoism.

2. The war was exterminationist, every German should have killed his wife and his children after April 1945. And this is correct if you look at the Germans of today. Would have been far more honorable than this disguting slavery. But the masses are masses and maybe only 50 years of National Socialism would have changed that. All real fighters that Europe still had, died in 1945. I really wish “they” killed all Germans in 1945, their racial soul was already finished for good.

3. I don’t care about Russian lives, they have fallen prey to Jewry; the Germans could have exterminated them to the last man for all I care.

4. Whatever nonsense you want to believe, in 1941 Hitler was left with only one option: invade the Soviet Union immediately, or face annihilation. Please read Paul Carell’s “Hitler’s War on Russia” ( Hitler Moves East 1941–1943 & Scorched Earth: The Russian-German War, 1943-1944) and the sources below.

5. I am no Christian, but you seem a quasi Jew lover. “Bolschevismus was a force of order” lmao gtfoh Dumb ugly enslaved goyim masses dying for the Jew = Order, I got it.

6. I would never go to war with you.

Sources:

https://en.wikisource.org/wiki/The_F%C3%BChrer_to_the_German_People:_22_June_1941

https://en.wikisource.org/wiki/Adolf_Hitler_Explains_His_Reasons_for_Invading_the_Soviet_Union

https://archive.org/details/TheFuehrersProclamationToTheGermanPeopleAndTheNoteOfTheGerman

https://streamable.com/timzr

Thanks for the honesty. Still, people such as Rudel or Savitri Devi chose to live, for better or for worse. Expecting the end of the cycle. Hoping that that had not been the last battle. I wonder what their spirits would have said now.

“3. I don’t care about Russian lives, they have fallen prey to Jewry; the Germans could have exterminated them to the last man for all I care.”

I didn’t mean it like that. I actually agree with you here – even more, Russia (and Poland, Ukraine, etc.) is now a corpse after having won the war. What I meant is that Nazis consider the Eastern Front some sort of an ideological war between the Aryan and the Jew, but IMO, it was much less – merely a Russo-German war, a conflict between two deeply flawed European nations. It only became mildly anti-bourgeoisie towards the end.

“5. I am no Christian, but you seem a quasi Jew lover. “Bolschevismus was a force of order” lmao gtfoh Dumb ugly enslaved goyim masses dying for the Jew = Order, I got it.”

Bolschevismus sent a man into space and disallowed its citizens to wear jeans. The USSR had far less migration than in modern times, and the White birthrate was falling a bit slower.

Jews were barely tolerated under the Soviet. The GDR helped Arab shitskins against Israel. The USSR was actively converting Christian churches into museums of natural sciences. It was the war that led to the reintroduction of religion, even the toleration of the dreadful Greek Catholic church in Western Ukraine (to me, anything less than hanging is toleration).

By the way, isn’t it sad that Germans supported the moderate Christian wing of Ukrainian nationalists (the OUN-M) instead of the more radical anti-Christian OUN-B? How can this be defended? I see it all as an opportunity squandered in the optimism, nationalism and close-mindedness of the NSDAP. Because Europeans cannot think religiously anymore?.. The Iranians don’t find it cringe to make a fundamentalist revolution. And in the DPRK, they venerate their Eternal Presidents. Whereas Germans only wished for a third Reich, bigger and better, and with a higher standard of fat living – not for some cosmic last stand against Christianity.

“When Russia was under boot of Zion, they mass-murdered millions of Russians and others – during their commie-reign, and then handed over the wealth of Russia to a handful of Rothschild’s “Russian” oligarchs, when they decided to go Western-style – ((crony “capitalism”)).”

Oh no. In what way was the USSR, a socialist state, under the thumb of capitalist conspirators?

“And that’s why Putin = Hitler, in the West today, because he thwarted the zio-plans for Russia to be looted and its people crushed.”

Yes, Putin is such a Hitler that the Russian nation is rotting from within, losing millions to emigration and drug abuse, and gaining millions of integrated Uzbek and Azeri migrants. Stop it, mate. Putin is Zion. Stalin was a bit like Orbán – limited mind, but stable course.

“Often they are described as geniuses, or madmen. On the other hand, they can be members of groups, but if they are, they will try to reshape the group into conformity with their own thinking rather than conforming to its standards.”

What’s about Alexandra Kollontai, Ayn Rand or Savitri Devi? Weren’t they opposed to their professed creeds enough? The USSR was not totally feminist, the conservative capitalists are not libertarian, and Hitlerians did not fully commit into allying with the swarthy men. In your mind, are they conformist to… what?

P.S. On an unrelated note, the latter two were born and died in the same years. Unfortunately, Savitri has so incredibly fewer conformist to her ideas men…

“It has been conclusively demonstrated that whenever women take over “leadership” positions in churches, those churches will soon be accepting of things like homosexuality and will stop speaking out against abortion.”

A friendly reminder that women never take over, they are given such power. And the said churches never objected to miscegenation for one.

P.S. My response to you from yesterday has been censored, I believe, it is visible on my profile page.

“If indeed, as I hypothesize, that Iran was brought down purposefully by the deep state of Mossad/CIA operation the only reason for it was because Iran was too good to be true. That Iran was too stronger and that Iran was going to be stronger”

Stronger as in having its women turned into sluts? How could Iran ever have been a threat if it had retained the same degenerate culture as the US?

The DPRK is a threat – because it has a will towards its future, pride in its history and the zeal to die for its ideals.

The USSR is no threat – their men have sold their vast country for a can of Pepsi-Cola, American rock anti-music and stupid American films.

It amazes me how people always ignore the willful castration of the USSR and still think the GDP is a meaningful number.

“While non-European immigration concerns only a minority of the population in Switzerland, several warning signs are showing that integration is proving difficult”

Do you racists still cling to this outrageous word in 2020? Impossible. Do you not understand that integration means race mixing? Miscegenation? The ultimate fulfillment of Jesus’ Commandment of out-group Love?

Switzerland is a rotting corpse as all other previously Aryan nations are, from New Zealand to Belarus. The fact this Alpine country (now mixed with Portuguese Negroes) gave its women the right to vote in an open referendum speaks volumes.

https://en.wikipedia.org/wiki/Women’s_suffrage_in_Switzerland

WW2? Germany? Muh’ evil Judaeo-Bolsheviks? The Holocaust? Germany’s failure? All pales in comparison to the death wish of Judaeo-Christians. The Soviet Union died like a gnat, the US is full of black transvestites… Switzerland is all the same.

https://en.wikipedia.org/wiki/1971_Swiss_referendums

“DPRK is a ‘Hermit Kingdom’ looking at its own navel. It is not animated by any ‘eschatology’ and revolutionary fervor to bring the end of times by the ‘Islamic revolution’, as the Mullahs of the ‘Shia arc of resistance’ are not shy to clamor to all and sundry”

Do facts corroborate this statement? Which country is more of a “hermit”?

Iran: Iraq, Syria, Yemen (and support for groups in Bahrain, Qatar, Lebanon, I might add).
https://en.wikipedia.org/wiki/List_of_wars_involving_Iran

The DPRK: Korea, Congo, Thailand, Vietnam, Israel, Ethiopia, Angola, Somalia, Grenada, Sri Lanka, Panama, Yemen (and links to Myanmar, Western Sahara and Burkina-Faso, I might add).
https://en.wikipedia.org/wiki/List_of_wars_involving_North_Korea#North_Korea:_1948–present

Iran seems far more constrained.

“He is at the center of the disturbance, not a mere participant in a disturbance caused by someone else. Their society’s violent reaction against those men is a useful indicator of the extent of their non-conformity.”

Savitri Devi was imprisoned and almost hanged, whereas Nietzsche was never explicitly punished by men.

Do you consider such heroic and immense persons as Himmler or Heydrich merely hypostases of Hitler? And can Hitler be considered a non-conformist if he was immensely successful and venerated in life? Is a true non-conformist always famous, at least, after death? Are the bombers of 9/11 too ordinary, insignificant men for you to consider them equals of Socrates?

I guess, I disagree about the inherent value in non-conformity. To me, there is one objectively correct ideology, and whoever professed it in history no matter the circumstances is to be admired. Sade does not become less degenerate due to his force of will and honesty, just like the soldier who shot the last Jew in Vinnitsa is no less of a giant due to his anonymity.

“Post WW2 Poland was run by a group of Polish Jewish Bolshevik traitors (eventually removed by ethnic Poles).”

It is surreal to read such gibberish under this very article… Is Switzerland run by Bolshevik Jews, too? Is the Maori-run New Zealand? Were it the Jews who instigated the Founding Fathers of the US to call all men equal in 1787? Or were it the Jews who made Whites kill each other in Anglo-America in the 1860s to give the Negro the vote?

Were it the Jews who made Negroes citizens of France in 1848?

https://en.wikipedia.org/wiki/Four_Communes

Those few Africans from the four communes who were able to pursue higher education and were willing to renounce their legal protections could ‘rise’ to be termed Évolués (‘Evolved’) and were nominally granted full French citizenship. Despite this legal framework, Évolués still faced substantial discrimination in Africa and the Metropole alike.

Jews again? They were only starting to get equal rights around Europe themselves, but were already manipulating poor innocent Whites into caring about the Negro? Seems more like a natural evolution of the Christian death wish.

“Joseph Stalin was right to order the murder in Katyn” – January 20, 2020, Yevgeny Satanovsky”

Satanovsky is a Jew. He has no right to talk for the USSR or Russia.

By the way, do you have an explanation for how the Katyn massacre was made using German ammunition? It’s not even addressed on the Wikipedia article. Because defending the USSR is physically impossible for a non-Russian. A mental barrier greater than that against Hitler.

“The mystery is not why the Nazis attacked Poland, but why Chamberlain made the guarantee”

Why? Because Hitler was not a conscious actor, but an idiot led by vengeance instead? Describes the situation perfectly!

It was Germany that started the war. And Germany that could have kept peace. What mental gymnastics must one employ to deny it…

“Stalin was given the plans by the germans no less who found out a plan by the british and french to attack the USSR and if Germany had not attacked then the UK/French would have.”

Source on this? And how is it relevant? If true, it makes Hitler a confirmed idiot – why give the English Jews a pretext for war, when they could have united to attack Russia instead?

“Far fetched?? Like how the US was going to use over 250 nukes and destroy over 60 major cities in the USSR?”

Oh no, this sounds so retarded… Don’t you tell me Russians did not have similar plans. Because everybody did. That’s what nukes are for – to explode over the assets of your enemy! Of course, cities would have been bombed.

“the Jews have momentarily blinded the world to the five-thousand year historic reality of unrelenting Jewish predation of non-Jews”

Why are you spewing such factually incorrect nonsense? Are you trying to mar anti-semitism with your lunacies? Check out Wikipedia – the Jewish people are not older than 3000 years. Not your “5 millennia”.

And the second point – what is this “predation” supposed to mean? Are you so ignorant of history that in your mind, only Jews preyed upon foreigners? Do a reality check! Anglo-Saxons raped Brits, Danes then raped the Anglos, Normans invaded France, then England, then France again… The history is full of hatred, and that’s OK.

“Oh the poor long-suffering Jews, boo hoo.”

And this… this is pure Christian axiology. The weak are good! Strength is evil!

A general difference between ancient Greco-Roman virtue and modern virtue can be glimpsed through the ancient sculpture, the Dying Gaul. The sculpture portrays a wounded “barbarian”. Whereas moderns would tend to imitate Christ in feeling compassion for the defeated man, its original pagan cultural context suggests a different interpretation: the cruel defeat and conquest of the barbarian as the true, the good, and the beautiful.

https://chechar.wordpress.com/2018/06/13/heismans-suicide-note-3/

“if J-supremacist Bolsheviks had not starved to death untold millions of the hardiest, most resilient, intelligent and independent of Ukraine’s people, as soon as these fiends had Ukraine by the throat”

A friendly reminder to any ignoramuses that the population of the Ukraine reached its absolute peak of 53 mil. people under the Soviet power (in 1993). Whereas under capitalism, it has faced more death and general decline than in the famines and WW2.

https://en.wikipedia.org/wiki/Demographics_of_Ukraine

Ukraine has been losing 200k-400k people a year for the past two decades. That is a White genocide far worse than muh’ Judaeo-Bolsheviks.

https://www.worldometers.info/world-population/ukraine-population/

“Dresden was full to the brim with Eastern European women and children fleeing for their lives from the genocidal Bolshevik fiend, who was unleashing its Red Army rapist orcs on Eastern Europe and Germany, now that the men were all slaughtered or dying a slow death in their gulags”

How can you say that with a straight face? Last time I checked, Germans were living in the German Democratic Republic just fine. They were not genocided. Unlike Belarus which lost 10% of its population in WW2.

The population of Belarus suffered a dramatic decline during World War II, dropping from more than 9 million in 1940 to 7.7 million in 1951.

https://en.wikipedia.org/wiki/Demographics_of_Belarus

Whereas the sodomite capitalism of the West brought nothing but ruin and misery after the Easterners had sold out their Socialist countries for a can of Pepsi-Cola.

About 1.7 million people have left the new federal states (the East) since the fall of the Berlin Wall, or 12% of the population;[26] a disproportionately high number of them were women under 35.[27]

After 1990, the total fertility rate (TFR) in the East dropped to 0.772 in 1994. This has been attributed to a “demographic shock”: people not only had fewer children, they were also less likely to marry or divorce after the end of the GDR; the biographic options of the citizens of the former GDR had increased. Young motherhood seemed to be less attractive and the age of the first birth rose sharply.[24]

https://en.wikipedia.org/wiki/Demographics_of_Germany

“I recognize from your “Adûnâi”, that you are a Jew.”

FFS, can you stop misreading my nickname? It’s U, not O, in the middle. From Tolkien’s legendarium. An allusion to Mitteleuropa, or between America and Russia.

http://tolkiengateway.net/wiki/Adûnaic

“Anti-Semitism and anti-Nazism are essentially the same, opposition to the criminality of exceptionalist cults.”

So, are you the same as the quacks on aryanism.net? Are you hating Jews because they want to kill all non-Jews? Are you the same as Christians who want to impose their rot on everybody, so that we all become equal in death?

“No country in Europe is as prone to self-destruction as the Poles. Their hatred of all things Russian has condemned them”

Russia is a melting pot of Tartars and Caucasian Negroes. Russia is murdering the Russian people first and foremost. Hating Russia is a decent idea.

…too bad when Slavs hate Russia, it’s all for the wrong reasons. I can’t speak for the Poles’ rationales, but Ukrainians despise everything good in Russia such as the remains of their racist thinking.

Still, even the vestiges of Russian self-consciousness look more like Black Israelism or Christian Identity. On YouTube, those anti-semitic and anti-capitalist videos get hundreds of thousands of views that also parrot inane nonsense about “Great Tartary” founded by Aryan extraterrestrials.

https://www.youtube.com/watch?v=Ovm0-Ta5NIo

Video Link

Probably the same as the Polish denial of the fact that their lands had been inhabited by Burgundians and Vandals before the Slavs came. Or the Belarussian claim that they were dominant in the GD of Lithuania.

What even is worse – this “pro-White” insanity or the clear honest death wish among Western liberals?

True. I expected to provide the destruction of the USSR via subversive “pro-freedom” activities as an example of Jews’ ruining an anti-Jewish country by making it more “free”… But of course not.

The USSR will forever be remembered (if not ignored) by Neo-Nazis as a bastion of evil “Judaeo-Bolsheviks”, facts be damned. There is a limited amount of points one can assign to breaking psychic taboos – enough to start loving Hitler (even in places where one shouldn’t), not enough to start respecting Stalin.

…the people composing the brain trusts and money-power leading the war on our civil liberties is the same as the one which oppressed people in the Soviet Union and oppresses Palestinians today.

This never ends… What has the Soviet Union got to do with your free speech? Why do you need Pavlovian-dog-like to insert a slanderous cliche unrelated to the subject matter by implying/stating that a tiny minority of Jews oppressed the Soviet people?

You might say that about the US now (after all they rule almost everything that matters) but not the USSR, not even in the early stages of Bolshevik rule when many Jews flocked to the anti-Tsar parties. The most vicious of the anti-Bolshevik groups were the Right Socialist Revolutionaries run by Jews. The Bolsheviks were the leading force of the Revolution and the victors of the civil war and foreign invasions (UK, France, Japan, US, Poland, Finland and others, plus 50,000 Chech troops stranded in Russia at the end of WWI) because the people were on their side. You cannot win a civil war without people’s support; after all, a civil war is a people’s war.

The slander is even more grotesque when recent history revealed that the “oppressed” people of the Soviet Union actually voted to be oppressed !!! (and for the uninitiated here, they even recently voted Stalin the 3rd most celebrated Russian of all time, ahead of all the Great Tsars and Tsarina). At the 1991 referendum for the preservation of the Soviet Union, 80% of the voters voted my a majority of over 76% in favour.

When writing banalities as this any serious reader dismisses what you say as baseless gibberish. What’s the point?

“Also Hitler never went whole hog. Women were only very partially mobilized and much cultural and social activity continued in the Reich all through the war(read Goebbels diaries).”

True. Adolf Hitler was a ridiculous coward. Never burned a single church in Germany. All you need to know.

“If Mussolini hadn’t invaded Greece and had to be bailed out by Hitler, Hitler would have invaded Russian on May 15th. It is quite possible the Wehrmacht might have gotten behind the Urals before winter and captured the Soviet arms factories.”

No, that is incorrect. And what’s up with the winter talk? Germans were stopped by the Russian Army and by the sheer distance from their bases in Poland, not by muh’ cold weather. And the Barbarossa had failed by September.

“He should have taken Vichy which would have forced Franco to allow the Germans to pass through and take Gibraltar.”

Vichy was an independent country that also had power over all of France’s colonies except for Cameroon and later Gabon. Germany could not have supplied a force in Africa larger than in history. Turkey could not have attacked the USSR through the Caucasus.

https://old.reddit.com/r/MapPorn/comments/dv0abt/territorial_losses_of_vichy_france_19401945/f79ozlw/

“Also under such conditions, the lend-lease arrangements would be likely to be more generous.
Hitlers military power had been built up by the Us/Uk and it was their proxyweapon and not an outcome from any german economic miracle like the naive are raving about.”

I don’t know if you are still active, but could you please present to me your explanation as to why the Anglos were supporting the USSR after 1941 and fighting Germany? To me, it seems obvious that the outcome of WW2 with the total Soviet victory in Eurasia was the worst case scenario to the geopolitical interests of the USA.

I greatly respect Stalinists such as yourself, but I believe this to be your blind spot. A Eurasia united under Moscow was a greater menace to the West than a Eurasia torn among Berlin, Rome, Tokyo, and even possibly London and Novosibirsk.

The only rationale for the Anglos to have fought Germany could be their hatred of the Aryan race’s rise in Middle Europe. And if their propaganda machine is as strong as many believe… why not at least switch lend-lease to Germany in 1944? And start bombing Russia?

Of course, you might say that the West easily defeated the victorious USSR after 38 short years (after Stalin’s death). To that I will say – we are all infected with the plague of Christian axiology, and the USA is already in its death throes. Geopolitics ultimately mean very little if every country is killing itself (except for Hitler’s Germany and the DPRK). That is what Stalin was too limited to see.

“The Us/Uk who bragg about having fought Hitler have had no qualms about supporting nazis in Ukraine.”

Last time I checked, there was no power in Ukraine that tried to ban women from universities and put Jews into gas chambers. Unfortunately.

Quite anecdotal, but I watched a few funny animal compilations on YouTube a week ago, and a lot of pets were from China. Is it correct to say the Chinese are more cruel than Westerners? Maybe it’s only the older generation? After all, I also saw a lesbian having an AMA on Reddit, she lived in inner China.

If anyone deserves extermination, it’s Taiwan.

https://en.wikipedia.org/wiki/LGBT_rights_in_Asia

https://kotaku.com/cosplaying-politician-elected-in-taiwan-1840984735/

(On the one hand, César Tort hates animal killers. But on the other, I hate sodomites. The world is so complicated…)

“At that time, around a third of the world population became infected at some point. That means about 2 billion people today, which can translate into as many as 60 million deaths”

I hate such useless estimates. Because they include the populations of Africa, India and Latin America – regions which humans have not colonized yet anyway.

A deleted comment in that Reddit thread provided an insight into the mind of the Chinese and Westerners.

There’s none of this politically correct crap in china. They will put an ad in the paper requesting hot girls to apply for stewardess positions and the entire train is serviced by smoking hot girls. It’s wonderful. If they get ugly or fat they get fired.

https://old.reddit.com/r/TrainPorn/comments/5o1u1z/bullet_trains_before_setting_out_in_wuhan_xpost/dcg7t4m/

Again, pure capitalism and Christianity. The Chinese see no problem with whoredom, and neither do Western libertarians. May Coronachan come and take away the sodomites.

I am not Jewish. I am a Russian/Ruthenian.

“Are you defending their criminal history out of tribal loyalty or just sheer stupidity?”

If anyone has a criminal history, that’s the White race. By praying to the foreign god of the Jews, by giving women the rights to owning property and by spreading sodomite degeneracy around the world. By wanting to die. That is a thing viler than burning children alive.

Jews are a fine nation, no better and no worse than any other. Especially now that they have their separate country in their ancestral lands. But you consider any display of strength as evil. You are infected. And many Jews are, too. There are sodomite parades in Jerusalem. It is the Whites who abuse those poor Jews, not the other way round.

“And in pursuit of it, the Poles immediately invaded Ukraine, going all the way to Kiev, to compel membership in this “alliance.” This little-known Polish-Ukrainian War starting in 1919 led to the much better known Russo-Polish War of 1920”

How can you be so horribly wrong? The Poles were allied with the Ukrainians when their joint attack recaptured Kiev from the Soviets! The war between them had already finished, and it had been waged for Lviv and Galicia! This attack in Ukraine was the result of their peace negotiations, where Petliura had betrayed the Galicians and given them to the Poles.

“If I could beam my thoughts into the minds of all disaffected white western men, I would say just one thing: Come to Russia if you want a wife.”

1. Russian legislation is the same as in America. The same divorce-rapes, the same property rights.

2. Russian women all go to the university.

3. Russian society is as focused on whoring and cock-carousel-hopping.

4. Considering American women a lost cause is defeatist. When the USD crashes and law breaks down, they can be captured and turned good.

“I am currently in east Europe. The place is full of lovely intelligent white ladies who seem keen to partner with a man almost old enough to be their grandfather.”

I don’t understand why the existence of expensive whores makes you optimistic. And I don’t get what in the feminist legislation of every Slavic country gives you hope. Russian women are every bit as slutty – they attain education, they work, they own property – and they divorce en masse.

“Americans are schooled almost exclusively in “Western” culture: geography, philosophy, history — poorly schooled, to be sure.”

What Americans utterly fail to grasp is the notion of a country. To them, America is not one, but a world unto itself instead. Borders are a poorly understood gimmick. And the idea of international wars? That makes no sense to them. From their sheltered position inbetween the oceans, the only matters close to their heart are “muh’ evil government” and “muh’ civil liberties”. That’s why even the brightest Americans badmouth Stalin – in their mind, international wars do not exist. Germany? Armies? Russia? It’s Hitler good or Hitler bad, not complex geopolitics and fight for survival.

“Your English is flawless. So are you a native and resident Ruthenian, in which case your command of English is truly impressive”

I took English classes from a race-mixing (with a Mongolian) post-Soviet Jew starting at 12. And curiously, I was never entangled in the Russian Internet.

“Strength in defense is honorable and noble. Strength employed in pursuit of adventurous aggression/conquest is evil.”

Evil is failure. It is a misconception, however, that a Darwinian naturalist perspective means an immediate war of all against all – it looks more like game theory. That’s why such sensible half-Christian ideas as that of a just war made some sense. But make no mistake – those who do not expand when they can take a risk and will be punished.

I consider modern West to be fully Christian – any expansion, any aggression is inherently evil in their eyes. This is why I am not blinded by their seeming splendour and might – their foundations are rotten, and their fate will be sealed in time.

“militarism-for-profit, death-merchants”

See, profit (and matter!) comes in different kinds. To an objective reality, true good is the furtherance of the interests of a race. The strengthening of an economic clique is not that. Economic profits will be for naught if they are not based on physical genocide. Take Rome – it grew steadily when it was colonizing Italy, but with the advent of the Marian reforms which turned a soldier from a peasant into a mercenary, the polity became rootless, superficial, idealist and thus doomed.

In short – America itself was half-decent when they were genociding the Amerindians, but when they turned to money-hoarding and market-exporting (replaced an ethnic empire with an economic one), then their descendants were robbed of the future.

“Essentially it is a statement originating from the primal pre-civilized element in all of us, by those still comfortable with the concept of rape and pillage — as long as it is them doing the raping and pillaging”

their*

Rome was founded on the Rape of Sabine Women. Ancient Germanics were constantly raiding the Empire for spoils – and payed the price when their calculation proved wrong. But not raiding comes at an opportunity cost.

https://chechar.wordpress.com/2011/12/21/lycanthropy/

But to you Christians, reality matters little. What is the difference between this concept of good for its own sake and plain suicide? Disregarding reality is easy when it is your supernatural JEW who created it and your supernatural JEW who will destroy it at the end times.

Rome was founded on sacrifice – for one’s tribe. As Mitchell Heisman put it, Christianity took sacrifice ad absurdum and posited it as an absolute virtue. Now pain itself is good and commendable, not what one is suffering for. Idealism and the hatred of Matter!

https://legacy.gscdn.nl/archives/images/suicide_note.pdf

“Meanwhile 50% of agricultural land in Russia is being destroyed by permafrost melt.”

Isn’t it the opposite? Doesn’t permafrost’s melting bring Russia more usable land for the future? And isn’t global warming a net positive for Russia anyway?

“Moscow itself has seen no winter this year.”

Isn’t this to be celebrated? Warmer climate is better.

Video Link

Media manufactured hysteria?

This and the previous article by the Russian Christian Orthodox Jew writing under the nickname Israel Shamir is another example that Jews may disagree and fight for different and even apparently opposite political causes, but when it comes to the global politics of extorting money from the whole nations, they cooperate brilliantly. The two articles by Israel Shamir are the example of the incredible huzpah in changing and manipulating the facts of the history of the II World War and of the history of the extermination of the European Jewry by the Nazi Germany.
The Roman Law valid in all the Western world’s law systems says that the citizen’s property left after his death without heirs passes to the state. Polish Jews who died exterminated by Nazi Germans were Polish citizens and so their property, sometimes preserved, but often partially or wholly destroyed, passed to the Polish state if there were no inheritors left demanding their right to the property. The same that would be the case in the U.S.A, Canada, Britain, France or Holland.
Now, the international Jewry needs always more money to impose its power on nations, so from the original shameless demand of $60 bln to be payed by Poland it passed to the $300 bln.
Now consider 3 basic facts:

“But the officers either genuinely knew nothing about the crimes of 1919-21 or stuck together, bringing down the collective punishment of the Katyn executions. It was not just, but it followed a certain logic of relations between the Polish and Soviet governments.”

Huh? What’s about the fact that the Poles were shot dead with German munitions? Why is everybody overlooking this gigantic fact? You Westerners are living in an alternate reality where sodomite sex is legal and where Katyn was perpetrated by the Soviets, and not the SS! So shameless. So surreal. It’s like they are ignoring straight facts staring in their faces. The same way as Wikipedia is talking about the non-existence of human races or the existence of so-called “genders”.

This world is insane. Only the DPRK remains.

“Yes, no court will participate in significantly damaging the conventional ‘Holocaust’ narrative — Irving v Lipstadt is another example.”

Wasn’t Irving utterly destroyed in that court case? Wasn’t he so destroyed, no racist should ever mention that happening as it is too humiliating, and their lies are all too visible?

Oh wait, we are dealing with delusional pseudohistory here where nobody reads the other side (such as Lying About Hitler by Richard J. Evans).

Denying the Holocaust is rejecting the Academia. Disregarding the Academia is the same as talking about extraterrestrial Hyperborean ancestors of modern Aryans – quackery.

“From each according to his ability, to each according to his needs!”
– Karl Marx, Critique of the Gotha Program

Could you explain why you consider this scary? Would you rather folks get more than they need, and less than they deserve?

Like human equality, it’s just another lie you tell yourselves to hold society together.

Do you consider society purely a machine disconnected from biology? That’s a myopic view. Sure, you are surrounded by such constructs now, but that has not been the sole case throughout history, and even in the current world is not absolute.

Think about it – nothing outside America exists to you, nothing outside modernity! Romans that burned Carthage and crucified their enemies; Germans who fought the said Romans and then the French; Nazis who gassed the Jews and burned their bodies – that matters naught to you! Because all you can see is the triumph of the technological civilization now, and therefore everything contrary to that is a fluke in your mind!

Possessed by Unabomberism, you are no different from a normie to whom anything else than the current is inconceivable. No different from a Boasian/feminist who sees social constructs everywhere and wants to break [free from] them. Is a gun that kills people with a press of a button so bad that you would rather die than try it out? Ought the violins be banned for only the vocal cords must be given a permit to vibrate? Is a socialist collective that bad if it is united in its hatred to Jewish individualism?

“142,000 Americans died due to pharmaceutical drug use in 2016, but that’s not news, either
But 100 Chinese–mostly born during WWII, malnourished and carrying a heavy disease burden–have died from a novel virus and that’s an epidemic?”

Two simple words (that nobody has uttered yet): herd immunity.

What a joke of an article. Do you believe China would have gone into a full panic mode without sufficient reasons? This article is almost as bad as outright lies (ignoring reality is quite similar to lying) – yesterday I saw a Russian conspiracy video by Vavilov on DenTV claiming the Chinese officials to have quarantined Wuhan on January 6th without an order from the CCP… Yeah, pure lies, 400k views. But this is just as bad.

https://www.youtube.com/watch?v=trSDXrTfazk
Video Link

“The remainder of your remarks I appreciate. However, when confronted with information like the following below, “I’m different” is completely insufficient to describe my response and, I hope, any civilized person’s response. People who do that (openly, I must point out; it looks like a street scene) are obviously humans, but what kind of humans? What kind of culture condones that?”

Do you consider Romans less cultured than modern sodomists? FLY, Romans used to crucify folks along the roads, and their roads were decently long.

What’s wrong with burning dogs alive anyway? They bark in a funny way when boiled, LoL.

I am no Christian, but I subscribe to the humane (from HOMINES:SAPIENTES, not modern faggoty “humanism”) supremacist view that Man is the master of the Earth (although Nature is ultimately higher, and Man is subservient to her, Nature is not animals – that is the crucial mistake NS made).

“In fact, the idea that man and his societies stand apart from nature is what I’m arguing against; and we should note that in the West, imagining there’s such a sharp division is a residue of Christian thinking.”

There is a division, and it is made mainly by Christianity, but also by individualist greed and lust. You seem to misunderstand me – what I am saying is that modern civilization is not an organic machine, and such inorganic monstrosities are not the only path forward. Republican Rome existed and triumphed over Carthage – that it was corrupted by wealth had not been predestined. Nazi Germany rose in the last century – how is that explained with your quasi-Marxist technological reductionist theory? There clearly are two forces fighting – if you can only see technology now, it does not bar Thor from rising again tomorrow and crushing the cathedrals.

“each species, each race, and each individual can be understood as a set of techniques encoded in DNA, so in this way all living things can be considered as a type of technological system”

When men make another system (such as throwing rocks at skulls, or printing money), and that system malfunctions consuming them, they might try and set it straight. History shows it can be done. Memes can be made subservient to genes.

“Can you be conscious without a brain? I don’t think so. The delusion that human beings aren’t really their bodies, but instead are “souls” distinct from their bodies, is another delusion encouraged (though, to be fair, not invented) by Christianity.”

Are you now a biological reductionist, too? There is no software without the hardware, yet are those tautological? Is a parliament a building with chairs and people, or is it a concept dealing with other similar concepts on a different level of reality? Taking psychotropic drugs may lobotomize you the same way as scratching an optical disk damages it – but in what way does that treat the psychical disorder or an incorrectly-written program?

Also, equating psyche to immortal souls is disingenuous.

“Hitler – betrayed by his fellow Germans, n.b. including “treue” Heinrich.”

This is a weird case because the entire idea of fighting till the end is controversial. Hitler did not have a monopoly on National Socialism or the fate of Europe. Everybody is welcome to try their own way.

“Manson – betrayed by “family” member Linda Kasabian.”

Hitler was not betrayed by women, at least. Could you explain your adoration for Manson for the sake of our mutual friend Chechar? Because to me, Manson is like Billie Eilish – a random American pop icon, quite a far cry from any collectivist terrorists the likes of Osama bin Laden or Kim Jong Il whom I consider true overmen.

“I heard a funny story that the CIA made Haftar change his name”

This article literally claims that Haftar is supported by the CIA, the RF and the UAE.

“After all, they made the Svoboda Party of Ukraine change their name from–get this!–the Social-Nationalist Party … too Nazi.”

Svoboda was so Nazi, it never wanted to exterminate the Jews, oligarchs or put women back into the kitchen. Stop with this nonsense that there are Neo-Nazis in Ukraine. Kim Jong Il knows, I would join them. Alas, there are none.

But it is true that Ukraine is a funny place. Social Nationalists, you say? Here male students can talk about “Cultural Marxism” in a public speech, and nobody (bar me) bats an eye! A physics teacher believes in magic and dowsing. The world outside the DPR of Korea is a mad place.

@Mike Whitney “Cubic feet”? Foot fetishism is out of bounds.

“The last time Turkey was involved in Libya, it was a happy and prosperous country, not a slave market.”
That “last time” was when Kadafi was alive, before Erdogan’s sadistic Misrata gangs tortured him to death. https://www.voltairenet.org/article171731.html
See also: “… in 2011 Turkey placed at NATO’s disposal [for training and arming] the militia from Misrata, a city dominated by the families of former Ottoman soldiers, often Circassians or Jews converted to Islam, who settled in Libya in the 19th century.” https://www.voltairenet.org/article208652.html
Turkey has been on board for destroying Libya from the outset. And now, Erdogan plans to take matters into his sole hands..

“You either conquer or get conquered; exploit or be exploited. In this regard, human societies are not much different than ants or bees.”

No, if this were natural, Americans would not take pride in a country that abolishes their rights of ownership over their own women, a civilization that serves the interests of Jesus and other non-Whites.

If you want a parallel with the natural world, it is closer to an ant colony whose queen has been killed and the power over which has been usurped by a spider. Then yes, patriotism is a natural signal, yet directed to the “anti-natural” (anti-host) ends.

The blind spot of my analogy is that Jesus never existed, unlike spiders, and that ants do not value personal comfort or the pursuit of happiness. (Nazi nonocausalists will say the spider is the Jew, but last time I checked, Israel had no future.) What remains is a psychic scourge of a suicidal civilizational meme.

“that may bring China down. They need our sympathy and compassion. Unfortunately too many deplorables here all they can express is an ugly Schadenfreude. Very sad. Disgusting.”

Why would non-Chinese be sad if China is destroyed? Do you understand the concept of separate identities? Or are you on drugs mumbling about how “we are one with the world”?

“Is it not now reasonable to suppose that this virus was deliberately made to harm Chinese people?”

This is a fascinating idea. Because if the CIA have indeed been behind this, they must understand that bringing China down will also mean the collapse of the capitalists system worldwide! And that means that César Tort is wrong – the Federal Reserve Jews are not as stupid, just the opposite – there is a mysterious elite hiding in the shadows and pulling the strings in the background according to some conspired plan.

Of course, this does not make the message on the Georgia Guidestones real – if they want to cull the population, why vaccinate all the Negroes? Why exterminate smallpox and poliomyelitis?

https://en.wikipedia.org/wiki/Georgia_Guidestones

“Why do you bother writing such obvious lies about Ukraine being a normal country?”

To me, all countries that are not at war with America are “normal”. All ideologies aside from NatSoc, Juche or fundamentalist Islam (Taliban, Al-Qaeda, Iran’s Shia Republic) are profane. Capitalists, Marxists, Christians, lukewarm Muslims – all are the same degenerate LGBT supporters.

I do not care about freedom, but the biological survival of my people. All want to die aside from the likes of the DPR of Korea.

“But not a single bookshop stocks any books by Marx or any Communist literature. I guess that is called “freedom”.”

Why buy physical books if you can steal/pirate them online?

“In the same way, white Americans are sacrificing their personal interests, and their specific racial interests, in favor of the interests of their greater unity as a nation.”

No, the [civilized humanistic] nation is the very anti-thesis of an ant colony. That nation is an inorganic memetic machine. Throughout history, even under traditional Christianity more or less, it was used as a tool of the genes. Now, it is against race and biology.

Your analogy would have been closer to the truth if you had seen civilization as a unity of “humankind” (because it is at least vaguely rooted in reality), but “mankind’ is too a memetic concept, and selling your daughters to Negroes is only comprehensible through the prism of Jesus-worship.

The DPRK is a superorganism because it unites 25 mil. closely related people, where a mere tribe united 150. This is progress. Not a crazed sick race welded together with the rubbish through the power of love – such a civilization is destined to lose its technology to begin with, and thus degrade into primordial inorganic chaos.

“What this comes down to is that you are still, under certain circumstances, willing to place humans outside of nature.”

By definition, there are three groups: 1) non-human animals; 2) hominins; 3) hominins of my race. The non-humans I shall preserve for future generations, my comrades should expect my support, and the foreigners that also compete with my race for resources should await my hate.

Yes, I put my race over the rest of animals. No, not over Nature overall. No, it does not make me an anti-racist.

“Thus, you have no problem with characterizing North Koreans as a superorganism, but because in your opinion the people are not closely related enough, refuse to do so in the case of the USA.”

This is literal anti-racism.

“Further, regarding memes and “memetic concepts”, don’t Koreans use them? And if they do use them, then why isn’t their nation “an inorganic memetic machine” too?”

Oh, they do. And it is a machine. I would not call fire organic, or its use not artificial. But in their case, they are driving such a machine, not are slaves to it.

“What’s “traditional” Christianity? And when exactly does some human behavior start or stop being natural?”

Back when women were barred from inheriting property. Or when the church was a wealthy hierarchical structure that controlled politics and created art. Objectively speaking, the Middle Ages were relatively decent – especially considering what came after Borgia, from Protestantism to industrialization.

If the English scientific revolution had happened 500 years later, but with the English fundamentalist Christianity’s not having materialized, I would take it.

Do you recall how the USSR was damaged morally after Chernobyl? This might be it, too. If the Chinese people destroy the Communist Party, it will be the end of the Chinese race as it was over for the Russians and Small Russians in the 1990s.

This coronavirus outbreak is nothing compared to the danger of capitalist anarchy that murdered and displaced tens of millions of Russians and Small Russians in the 1990s, 2000s and 2010s, and could as well turn the Chinese into LGBT faggots of the USA.

Only if you find Western media credible–about anything (as 6% of Americans do) and believe their nonsense about China. Here’s the scoop:

“Li Wenliang, a low-level physician at a hospital in Wuhan, learned at the end of that initial two weeks that some patients had been hospitalised with a coronavirus infection, impetuously presumed that virus to be SARS, then posted announcements on Chinese social media that SARS had returned to China with people in Wuhan already hospitalised.

“No one in China has forgotten SARS, these messages sparking alarm and panic, especially since they were forwarded in volume to many other recipients. Li was picked up and questioned by the police, reprimanded, and released after an hour. This was when the Western media began their circus.

“First, it is a crime in China to fabricate and spread rumors that disrupt the social order, a portion of Chinese culture that Westerners either cannot understand or refuse to accept. Li stated “I only wanted to remind my university classmates to be careful”, but when his startling messages went viral, he then admitted, “When I saw them circulating online, I realised that it was out of my control and I would probably be punished.” Hardly a surprise.

If Li’s concern were for a few friends he would have called them or sent private messages. Li is not a child, and he was fully aware of the virality of online posts as well as the protocols for dealing with potential epidemics. To have posted his claims openly on social media could obtain only one possible result – in fact the result it did obtain, which was to alarm and panic countless thousands of citizens.

Li was not reprimanded for “telling the truth” or for being a “whistleblower”, as CNN, CBS and the BBC tell us.

“Rather, he was reprimanded for reckless public behavior and for presuming authority he did not possess. No one appointed him the spokesman for either the national health authorities or the hospital. Li had no authority to make such premature public announcements, and he would know very well the result of a WeChat post with such content. From the same CNN article, Li wrote, “I was wondering why (the government’s) official notices were still saying there was no human-to-human transmission, and there were no healthcare workers infected.”

The medical authorities released that information as soon as it was verified and public notification became necessary, but Li appears determined to denigrate them with backhanded insinuations of lying to the public.” –From Larry Romanoff’s, ‘China’s Coronavirus – How the Western Media Spin the News’
https://www.globalresearch.ca/china-coronavirus-how-western-media-spin-news/5702888

“So, racial diversity is another thing that both superorganisms and human beings have in common.”

The difference with the bees is that technological civilization cannot be upheld by the Brown races. The moments hominins miscegenate, their memetic cultures degenerate, their machines rust. A miscegenated “superorganism” effectively does not exist – it dies a few centuries after being ushered into existence. (Hellenic kingdoms, Rome, America.)

“There you go with the free will stuff again.”

Do I? Are all psychic processes manifestations of free will? Do you deny the independent of biology existence of psyche?

It is not free will but the dialectics of psychohistory. The processes are not arbitrary, but are the resolution of the inherent contradictions of culture. Yes, they are based on the genes, but those are not exhaustive. From Montaigne to Marx, racial Jews have been caught up in the European memetic space, and thus have produced something conceivable to the rabbi’s flesh-eating culture.

“Women could own property in the Roman Empire, both before and after the Christian takeover, and in Sparta.”

In Rome, when it degenerated into an anti-racist economic empire. In Sparta, because their men were at war, and their women were forced to dominate their slaves.

“As far as I know, it’s not typical of Christianity, and I see no reason why you’d make that your criterion of what’s traditional or not. Just the fact that you personally approve of it is a pretty flimsy reason.”

Galatians 3:28. The Quran at least has numerous passages limiting women’s rights. Alawites can afford rejecting the existence of female souls outright. Whereas Christianity was cucked in antiquity (female deacons), and is now again.

https://www.thereligionofpeace.com/pages/quran/women-worth-less.aspx

Objective reality approves of stripping women of their rights, as a society which does not, vanishes from existence. Traditional here = a higher degree of pagan, Aryan, healthy.

A great article! I wonder why the Western media are still trying to paint China black – isn’t every single American fuming at his mouth at the mere sight of any totalitarian socialist regime? Every single YouTuber is doing their work for them. Maybe just fodder for Wikipedia…

If this virus had only killed old people, this would have been a gift straight from the gods to China.

Still, why had the Party not banned the consumption of wild meats by 2020?

First, of course, they had to put those people into poverty. I mean, before they could “lift them out”.

Do you even history? Before 1949, China was in the Middle Ages. No technology, no roads, no cities, no medicine. Only bands of warlords killing one another, and the Japanese.

Poverty was the state of all hominins from 4k BCE to 1.9k CE.

The only argument here can be made that any government could have done the same, not just a socialist one. But that is debatable.

“There is a simple way of deciding which government is most likely to have designed, created and unleashed a bioweapon.”

Can you explain why Americans would ever decide to use a bioweapon “against China” if such an action would destroy the capitalist system around the world and cause a civil war in the U.S.? Are they suicidal to kill China? Or is this the best-case scenario for them? Or do they actively seek to crash the capitalist system?

China really should copy and translate stuff like this comment for the Chinese public.

So the Chinese public would understand how much hatred there is for them out in the world. Simply for them being Chinese.

Then they should prepared for war and to kill them all when shit hits the fan.

Why let toxic fuckers like this live if they want to kill you for no other reason then you are Chinese?

I really feel sorry for the Chinese.

Remember, fight back, and having the ability to end them in a single fight will save the rest from these toxic as fuck lunatics.

“It is typical for any authoritarian system that perceives openness as weakness. If China wants to change the tone of the narrative it must shows its weakness and vulnerability and start asking for help.”

Openness is a trademark of gays.

Never say sorry to Americans! The same as with SJWs – every American is an SJW effectively, they will never tire barking at you, the only way is to ignore them until they die from AIDS and shut up forever.

“Don’t you find it strange that China is blamed among the conspiracy theorists? That China is trying to self-harm itself?”

That’s not weird at all. That was the standard response of Ukrainians to the Donbass – “they are bombing their own houses”. Literally. And of course, nobody cares that it was Ukraine that attacked the Donbass, they did not consider their side the aggressor.

China will self-harm because they are EVIL.

“So the Chinese public would understand how much hatred there is for them out in the world. Simply for them being Chinese.”

Exactly. I supported China against Hong Kong. I supported Blizzard’s decision to punish the RoC propagandist in October. I am incredibly alone. The masses of the West are in a frenzied hysteria against anything Nazi, Soviet, Chinese or Juche. No arguments work. You cannot even conceive that Katyn was perpetrated by the Nazis. Or that Stalin was anything but a “mASs mUrDERer”.

It is like a social media outrage over Warcraft III: Reforged, but on an even larger scale, with even more lies and stupidity, and kept alive for decades. HBO’s Chernobyl full of lies? They gobble it up. Another southern Korean lie about allegedly “dead” North Koreans that routinely return back to life? The NPCs want more lies from the “defectors”!

“Imagine if it goes to India, Africa and other developing countries, how many millions will be infected?”

Why would that be a cause for grief? The fewer subhumans, the better. Personally, I am delighted that the DPRK’s quarantine seems to be working.

There is no humanity, there is nation. And nation is more than a sum of individuals.

“The immense venom with which some news media and online sources have attacked Chinese of duplicity and laziness dont surprise me”

But how does that reconcile with the rampant pro-Chinese propaganda in Western media regarding domestic anti-Chinese sentiment? As folks say, “Let the chink cough on you to proof you are not racist”. Or do you mean the anti-Party rhetoric? Because Westerners physically cannot utter a positive thing about any socialist party in history, this is nothing out of the ordinary.

“Are you referring to the extent of the anti Chinese(leadership) sentiment of the mainland Chinese highlighted and exaggerated by the western media ?”

No, I mean the general anti-racist rhetoric of the Western media. My question is this. How can you say the Western media are anti-Chinese if they will never condone building Auschwitz?

Or this. How are the Western media anti-Chinese if they tell Westerners to let chinks cough in their white faces to prove said Westerners not to be “racist” against said chinks?

But you are most likely a myopic anti-White “socialist” – a generic Christian who thinks America wants to kill all non-Whites (I wish).

“This isn’t over. Zionist elements in U.S. government have decided that to maintain dominance it is simple to assassinate (Soleimani) and use bio-warfare (Wuhan). Neither of these types of actions are the work of rational adults in an open room. They are the actions of ruthless psychopaths who have infiltrated the corridors of power throughout our world.”

If Americans had wanted to control the world, they would have conquered and exterminated Mexico by the 1890s. They would have conquered and exterminated the Philippines. They would have conquered and exterminated Japan in the 1920s.

They would have dropped nuclear bombs on Rio de Janeiro, Cairo, Delhi and Singapore in the 1940s.

Instead, Americans have cured the diseases of non-Whites, gifted non-Whites their own weapons and their own technology.

And yet still the Negroes are screaming about how barbarous White man is! Truly, to shut that whining voice, either the Negro or the European shall perish.

P.S. Why does your comment have a golden border?

You are unaware that there was widespread cannibalism in some provinces during The Great Leap Forward? A little reading might be in order for you.

65 million dead from famine in that little policy failure. These were deaths that resulted from an intentional policy. Note that there was at no time any famine in Taiwan. Because they did not intentionally attempt to implement communism.

Capitalists are as likely implementing disastrous polices as communists. While the famine during GLF caused 16.5 million-30 million (2.5%-4.5% of the population) excess deaths in China, WW1 killed 20 million, or more than 4%, of the European population. WW2 was even worse: it killed more than 80 million worldwide, and maybe 40 million in Europe, more than 7% of its population. While the famine during GLF did have some natural causes (China did experience drought and flooding), both World Wars were purely man-made disasters.

1. Small countries that did not implement communism. None of the three, in particular Japan or Taiwan, is resource-rich in comparison with China, which has a large population but also a large land mass.

No, Japan is not communist, and it has an 80-year head-start over China since Meiji Restoration in 1868. However, that did not prevent it from making extremely bad decisions and bringing utter devastation to itself. By invading China and SE Asia, and initiating the Pacific War, Japan lost at least 3.1 million, or more than 4%, of its population. In addition, anywhere between 3 million to 14 million in Asia were killed by Japanese atrocities, depending on who you ask.

2. China cut itself off from the world. It was intentionally attempting autarchy. And now that it has not cut itself off, it can be more prosperous. But the underlying point is, I suppose, that China’s rise depended on the evil West and could not have been achieved without the evil West.

Nothing could be farther from the truth. China tried to establish good relations with those 3rd world countries that were not under the yoke of the West. They sent medical and construction teams to Africa. They played a rather active role in the early days of the Non-Aligned Movement. The west corporate elites had little intention to help China. What they liked was China’s cheap labor and potential market. I think they underestimated China.

3. What wars did China fight to defend its borders post 1949? Ther was alittle tussle with Vietnam. A spat with the Soviet Union. An aggrandisement in Tibet. Hardly big enough to hold China back. Or do you mean the constant threats against Taiwan’s borders?

The Korea War pretty much established China’s status in the international arena. China’s later development of nuclear weapons renders further actions unnecessary.

4. China’s technological progress strangely always lags that of the West. Funny that. Couldn’t be because it always relies on technogical transfers of some kind (forced transfers, theft, spying, etc)?

China has catched up or is already a leader in many fields: 5G, quantum communications, AI, supercomputers, satellite navigational systems etc etc. Not only that, China now has the world’s best academic institutions. It’s just a matter of time that China will pull farther ahead in many areas:

https://www.nature.com/articles/d41586-019-01920-1

It’s too late to accuse China this or that. The matter of fact is that industrial espionage is universal. Every developed countries developed by stealing other’s secrets. Only a fool will not do it. Only a hypocrite will criticize it. And only a looser will complain about it.

The point remains…the tyrranical and totalitarian system that dominates China is not responsible in a positive way for its current degree of economic prosperity. That is a result of Western forms of science and social organization. The Chinese aspects of Chinese government are in fact what hold it back.

China’s current government is a far-cry from the days of GLF and Culture Revolution. It will keep reforming, evolving, and improving. Time shall tell which form of government will be best for China in the future.

Many in the know, believe America has two options

As strange was it seems

The first occurrences in December appeared.

suddenly began telling it’s soldiers

CNY 2020 devistation!

Not fewer than five mistakes in one article! Do you even proofread?

At the beginning of February, Syrian daily newspaper Al-Thawra also claimed the coronavirus and other outbreaks were part of a US-China war.

“From Ebola, Zika, SARS, avian flu and swine flu, through anthrax and mad cow disease to the corona[virus] – [all these] deadly viruses were manufactured by the US and threaten to annihilate the peoples of the world,” the report alleged.

Typical magical thinking spewed by the low-IQ shitskin races of the world. Do not get me wrong, I understand this sentiment – yet it is merely an expression of their genetic hatred towards Aryans and Jews. There is no point using one’s brain to understand their thoughts logically.

If they used their brains, they would see a simple pattern – everywhere an American has gone, peace and prosperity have followed through. Everywhere where Americanism reigns, the Aryan dies, and the shitskin subhuman triumphs.* So what is to be afraid of for non-Aryans? Nothing. Their hatred is irrational as a matter of logical discourse – yet it is indeed meta-rational if one sees it as a tool of their rational racist hatred.

*Americans could have easily exterminated Mexico, the Philippines and Japan by 1945, but instead they implemented birth control in their own whorish lands, and vaccinated the Brown children. If you fail to see this biggest of jokes, you are blinded by the Red Giant of Christian liberal humanism.

I do not even have to read the entire article to say it is somewhere between Dog Barf and Bull Shit.

Just horseshit strung together to make people who do not know anything about Virology or Immunology or Biology or Medicine shiver in their boots.

I believe the authors are CIA folks trying to act like Bio-warfare is something real today.

It is not.

Also, lets look at reality for a second even if the US of morons, who can’t find their assholes with a mirror, could actually make such an amazing weapon.

1. No matter what anyone says you cannot control such a weapon. It will come back at you and kill you too. It is a biological entity and you have no control once it is released into the environment.

2. Look at the economic collapse that may be coming soon because of the slowdown in China’s Manufacturing of everything the world uses and needs especially the US of morons.

3. Nothing that has happened yet with the Corona Virus is unusual except to some $hit eating moron who wrote this pile of garbage.

Ron Unz has made a disgrace of himself by putting this crap on his website. I do have great respect for the site overall, but now none for the Editor.

Yesterday, I checked top 9 political parties of the Republic of Ireland on the matter of LGBT acceptance. Only one was against sodomy, one (Aontú)! And who is its leader? Peadar Tóibín (Peadar sounds suspiciously close to Russian pidor – paederast). LoL. And it got 41k votes! 1.9%!

https://en.wikipedia.org/wiki/2020_Irish_general_election
https://en.wikipedia.org/wiki/Aontú

Even this fat ugly woman “politician” has left the faggot circus and joined it. Where are the men? Where are the patres familias?

https://www.belfasttelegraph.co.uk/news/northern-ireland/sdlp-councillor-quits-party-over-same-sex-marriage-vote-and-joins-aontu-38348652.html

Why aren’t the DUP campaigning in the Republic of Ireland? Are there so few homopbobes among the Catholic worshippers of Jew Jesus?

https://en.wikipedia.org/wiki/Democratic_Unionist_Party

“Have you seen someone who have been foot bind-ed?”

Was foot binding not a far better practice than modern incessant whoredom? Would you rather not take it over the new individualist rot of the Chinese society?

“Your professed indifference to slavery is exactly why it happened. People like you condone it and let it happened. It is exactly of people like you that it lasted a century before it was abolished.”

I for one oppose the enslavement of foreign races out of my fear of miscegenation. Not out of my disgust for slavery per se. Deal?

“Our leaders in business and government have brought us to a point at which a plague in China will destroy our livlihood in America — even if Americans don’t get sick. If the coronavirus, or some other illness in the future, becomes serious, the globalist system of which we are a part will suffer.”

This has been the case at least twice throughout history – in the Bronze Age collapse of the 12th ct. BCE, and during the fall of the degenerated and Christianized Roman Empire in the 3d-5th ct. CE. Our turn seems to be up, especially considering the failure of Hitlerism.

“That’s the whole motivation for the Yellow Vests in France. They were told they had to pay massively higher taxes, to save the planet, as France became flooded with super-prolific people from the Third World. (Oh, and they had to pay taxes to pay for that, as well). It’s a wonder they didn’t bring back the guillotine for Macron. (who deserves it, if anyone ever did ; ).”

Then why are they not murdering the immigrant Negroes? Why are they letting the swarthy-skinned inhabit their sacred temples? I believe you to be sorely mistaken. No Aryan in his right mind wants to exterminate the Neanderthals of this world, or to preserve Nature. All he wants is lower taxes, higher pay, and peaceful death when his daughters mingle with foreigners.

There are a couple of fresh scientific papers out that examine the nucleotide sequence of the virus. One whose full text is openly accessible is here

https://www.tandfonline.com/doi/full/10.1080/22221751.2020.1719902

For the most part, the virus genome fairly closely resembles a known virus stain from bats, but the surface proteins – the ones which are most important in determining host cell type and host species – show striking variations from any known corona virus; in particular, there is one short protein sequence that shows extensive mutations and deletions (gaps) when aligned to proteins from other corona virus strains.

For your convenience, here is the protein sequence in question (as one-letter code)

MAYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP

You can search for it here

https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome

It will tell you “No significant similarity found.”

This means that this protein sequence, or indeed anything recognisably similar to it, has not so far been observed in the wild, or otherwise been obtained and published in the open literature. It thus is unlikely to have been acquired by the novel strain simply through the exchange of gene fragments with another virus strain. This indeed suggests that the new virus may have been engineered in a laboratory.

I don’t engage in the vanity that I have the power to upset or surprise God. He (It, Whatever) knows all. And as profound and intriguing as some human’s lives no doubt are (to other humans), I still imagine that everything going on in the vast universe, is rather more wonderous and encompassing (taken on the whole) than the (occasionally enigmatic) antics of humans, on planet Earth.

Is this logical, however? How do you infer that big JEW cares little for every human life from the dogma that he knows everything? In our society, there are people that devote their lives to ants (and those are even less relevant to us than microbes). I would posit the opposite – if big JEW outside & above Nature exists, he would care for every little life even more than the living themselves.

I’m not always sure there’s a God, but I am sure there’s a devil. And he resides in that damnable, intractable, human imperative for domination of his fellow humans. Power. At all costs.

If Aryans of America had been greedy for power enough, they would have long since nuked the Third World, and thus there would have been no overpopulation. But of course, that’s a blind spot of yours. Meanwhile, Zuckerberg has mixed his precious Jewish blood with a Chinese… They are destroying themselves just like the USSR right in front of our eyes, and you are still afraid of White man’s [suicidally ever weaker] desire for power!

P.S. “The important thing for them, is to exploit the rainforests” – Could you stop putting commas between the subject and the predicate?

“Why has Sweden let in so many Arabs? Are you going to blame that on the Jews? Which ones exactly? What about Greece? How did socialists ever gain a majority in Greece when Hitler killed off their tiny Jewish population?”

You are on the right track from the myopic monocausalism. But why are you blaming “leftism”? Do you not see that it is the Christian axiology that has equated the worth of all hominin life, European and non-European alike? It was the Catholic church that posited the existence of human rights for Amerindians in 1537.

https://en.wikipedia.org/wiki/Sublimis_Deus
https://chechar.wordpress.com/2012/02/21/red-giant/

That map is outdated. Sweden now fully recognizes both Israel and Palestine.

https://en.wikipedia.org/wiki/International_recognition_of_the_State_of_Palestine

I’m astonished at the normally astute Patrick Cockburn’s elementary misreading of Sinn Fein. That party has long since ceased to be traditionally nationalist, especially in the Republic. In fact they’re the poster children for globohomo, at the forefront of gay rights, same-sex ‘marriage’ and possibly the most ‘progressive’ when it comes to divorce and abortion.

Their most damning betrayal of Ireland lies however in their policies on open borders which will exacerbate the ongoing ethnic dilution of the native population here. Their bloviating about the cost of accommodation and the difficulty in gaining access to schools and healthcare makes their position all the more hypocritical and renders the party’s name (Sinn Fein means ‘Ourselves Alone’) an inversion of reality.

“I believe in what Charles DeGalle said, that they should have a Europe of nations, rather than a nation of Europe.”

Is that feasible, however? How can you wage wars of extermination against Turkey, Algeria and Egypt with a disunited Europe of varied cultures? Or do you think the fate of the continent to be an eventual bourgeois slumber?

Just as no one had ever been a Nazi in postwar Germany, no one in HK in 2030 will ever admit to having been yellow.

Why would you ever take the ravaged and castrated post-1945 Germany as an example of anything good? If anything, modern China = Nazi because they are proud of their country, have a strong Party and a willful Leader, and oppose America.

or more likely, a white parasite gweilo…because no one who have actually done a honest day of work in their life will say that LESS tourists is better ANY PLACE IN THE WORLD.

Interesting. Aren’t tourists effectively parasites? Aren’t tourists an eye sore? Aren’t tourists a threat to morals?

Dirty tourists spread disease. Degenerate tourists fuck your women. Lazy tourists turn your men into servers.