The Unz Review: An Alternative Media Selection
A Collection of Interesting, Important, and Controversial Perspectives Largely Excluded from the American Mainstream Media
 Metallicman Archive
Was the 2020 Wuhan Coronavirus an Engineered Biological Attack on China by America for Geopolitical Advantage?
🔊 Listen RSS
Email This Page to Someone

 Remember My Information



=>

Bookmark Toggle AllToCAdd to LibraryRemove from Library • BShow CommentNext New CommentNext New ReplyRead More
ReplyAgree/Disagree/Etc. More... This Commenter This Thread Hide Thread Display All Comments
AgreeDisagreeThanksLOLTroll
These buttons register your public Agreement, Disagreement, Thanks, LOL, or Troll with the selected comment. They are ONLY available to recent, frequent commenters who have saved their Name+Email using the 'Remember My Information' checkbox, and may also ONLY be used three times during any eight hour period.
Ignore Commenter Follow Commenter
Search Text Case Sensitive  Exact Words  Include Comments

[Portions of this article were drawn from various sources as cited. However, additional portions seem to have been quoted from Larry Romanoff at Global Research without proper citation.]

It does seem farfetched, doesn’t it?

That the United States will risk World War III, using nuclear weapons, by launching a coronavirus inside China during the 2020 Chinese New Year celebrations? But that is exactly the scenario that I fear has occurred.

Here we discuss this horror.

If this is the actual case, and it is actually intentionally engineered and used against China, it means that the USA is flirting with global nuclear annihilation. This is nothing that should be treated lightly.

Maybe not so far-fetched. When you get into the details

Introduction

Many in the know, believe America has two options when it comes to winning a world war against China and Russia. Also, what most agree on is the fact that America cannot win a conventional war against either power, or both.

Can America Win World War III? A Critical Analysis

Officially called the novel coronavirus (2019-nCoV), the contagion is a respiratory illness , a new type of viral pneumonia, in the same family of infections as SARS and MERS.

It highly contagious. It’s of a factor many, many time contageous than any other known virus.

High Contagiousness

Indeed, if we compare how SARS spread out in 2002-2003, it is hard not to notice how much more contagious nCoV-2019 is compared to SARS.

It took SARS three months to reach to the point of 300 cases between November 2002 and February 2003. In the climax of SARS, the daily number of newly registered cases in Mainland China never exceeded 200 cases.

In comparison, on 28th January 2020 alone, 1459 new cases of nCoV-2019 were reported nationwide, including 315 cases in Wuhan. In just a week between 20-28 January, the number of patients with nCoV-2019 exceeded the number of all SARS patients confirmed in Mainland China between 2002-2004!

Mainland China had just 5327 cases of SARS, but nCoV-2019 already had 5974 registered cases by the end of January 28th, 2020.

Coronavirus: Summary to date & insights

Taken alone, it’s just “another” viral agent. Only this time it’s much stronger. However, taken in context with other events, other systems, and other considerations it points to some very serious conclusions; conclusions that are far too hard to ignore.

Everything seemingly points to biowarfare being waged against China.

Crazy! Right?

No nation would be so crazy, so stupid, so insane, so evil… as to launch a very deadly WMD inside a nuclear-armed world power on their most important holiday. Right?

Who would be interested in doing this?

The calls for drastic and immediate action against China are all over the major American neocon publications. Just because you (personally) are not aware of them, does not mean that they do not exist. These neocons are foaming at the mouth for a fight.

Who are they?

The culprits are the dominant Western Powers. Which pretty much is America and it’s allies (namely Britain). The objective is to put “stress” on China in a combined effort to contain her growing power and influence.

It seems so far-fetched.

No one would be that crazy, that evil, that insane to want to hurt a successful nation full of hard-working and family loving people. No one, unless…

…they are ideologically motivated.

Negotiation is not a policy. It’s a technique. It’s something you use when it’s to your advantage, and something that you don’t use when it’s not to your advantage.

John Bolton

During the 2020 Chinese New Year celebrations and mass-migration, a very dangerous and lethal virus exploded all over the nation.
During the 2020 Chinese New Year celebrations and mass-migration, a very dangerous and lethal virus exploded all over the nation.

This should not be a trivial concern.

To accuse the United States of doing so is not to be done lightly.

All that is presented herein is, of course, speculative. I sincerely wish, hope and desire that it is not the case at all.

Wuhan virus in 2020.
Wuhan virus in 2020.

As it is pretty much a yearly event to have some type of flu or viral outbreak in China. The Chinese government is well-equipped to deal with these outbreaks.

But this time, it’s really… really different.

However, what is different THIS TIME is that the virus is[1] new (not a strain of an existing virus),[2] extremely aggressive,[3] launched during the yearly Chinese migration, and[4] comes at the heels of a wide spectrum of American instigated attacks on China during the “Trump Trade Wars”.

Swine flu was propagated by drones

As strange was it seems, the complete collapse of the pig farm industry in China in 2019 was propagated by drones. This is why so many isolated pig farms became infected. “Criminal elements” were using drones to spray the pigs with flu to devastate the pork industry.

“Criminal Elements”.

This is the Swine-flu pandemic in 2019.

Have you ever heard of this?

The idea that drones would spread a virus was intriguing.

  • Who designed and modified the drones?
  • Who manufactured and modified them so professionally?
  • How were the drones in the South of China, equal to those in the West, North and East?
  • How can the pig farmers get a hold of the same viral agent?
  • Meanwhile the Western media isn’t reporting on the drone use to decimate the pork industry.

It’s using technology to destroy an entire national industry. And it’s blamed on “criminal gangs”. I know that gangs are powerful, but why would they ever want to destroy a national resource?

That is like Tony Soprano conspiring to sink every container ship in every port in the United States. It does not add up.

Tony Soprano
Tony Soprano

Trump trade war went “hot”

For some reason, ever since the “Trump trade war”, China has been hit with unusually dangerous and lethal germs, viral agents, and illnesses that has attacked livestock and people.

The Chinese chicken industry was almost wiped out in 2018 by the bird flu virus.
The Chinese chicken industry was almost wiped out in 2018 by the bird flu virus.

You do not need to believe me.

Just Google for viral outbreaks in China. It’s all over the place. It’s everywhere.

Ever since President Donald Trump became President and incorporated Neocon “War Hawks” on his negotiation team, China has been wracked with all sorts of[1] new,[2] novel, and[3] unusually lethal strains of viral agents. All of which cripple the Chinese people, food and livestock.

They have been relentless, and their control of the American media is such that no one notices or cares about their activities.

Swine flu devastated Chinese pork production in 2019.
Swine flu devastated Chinese pork production in 2019.

History

Firstly, let it be well understood that this particular virus was patented in the United States. A U.S. Patent For ‘An Attenuated Coronavirus’ Was Filed In 2015 And Granted In 2018. Let that sink in…

Now, let’s begin with some strange “goings on” in Canada in 2019.

In March 2019, in a mysterious event, a shipment of exceptionally virulent viruses from Canada’s NML biological labs ended up in China. Canadian officials say the shipment was part of its efforts to support public-health research worldwide. They claimed that it was just normal procedure. What is unclear is why it was done in secret, and why the Chinese officials lodged a complaint. For certain, if this was just a routine transfer, the Chinese government would have been notified.

Keep in mind that this was during the peak of the Trump trade wars, and at a time when remotely operated drones were spraying swine flu and decimating the Chinese pig population.

Four months later…

In July 2019, a group of Chinese virologists were forcibly dispatched from the Canadian National Microbiology Laboratory (NML). The NML is Canada’s only level-4 facility and one of only a few in North America equipped to handle the world’s deadliest diseases, including Ebola, SARS, Coronavirus, etc.

People have speculated that there might be a connection between these two events. Perhaps, they wonder, that the Chinese have been stealing the weaponized viral agents. Perhaps, they wonder, that they were caught and then expelled from NWL.

But maybe something else was going on.

Perhaps, something else that had to be done in secret and kept away from the Chinese scientists.

Three months later…

On October 18th the Johns Hopkins Center for Health Security, in conjunction with the World Economic Forum and the Bill & Melinda Gates Foundation, brought together “15 leaders of business, government, and public health” to simulate a scenario in which a coronavirus pandemic was ravaging the planet. Major participants were American military leadership, and certain neocon political figures.

The Chinese were not invited. This is unusual, as almost all the major viral outbreaks for the last decade occurred inside of China and Africa.

The members took notes, and then returned to their day to day operations…

The very next day

300 US military personnel arrived in Wuhan for the Military World Games on October 19.

The first coronavirus case appeared two weeks later, on November 2.

Keep in mind that the Coronavirus incubation period is 14 days. So, fourteen days later…

The first occurrences in December appeared.

Here is a statement from StatNews (“DNA sleuths read the coronavirus genome, tracing its origins and looking for dangerous mutations,” January 24, 2020). It’s a bit complicated, but read it over, and then I’ll comment:

“Given what’s known about the pace at which viral genomes mutate, if nCoV [the coronavirus] had been circulating in humans since significantly before the first case was reported on Dec. 8, the 24 genomes [from, presumably, 24 different samples of the virus in 24 people] would differ more. Applying ballpark rates of viral evolution, Rambaut [one of the “experts”] estimates that the Adam (or Eve) virus from which all others are descended first appeared no earlier than Oct. 30, 2019, and no later than Nov. 29.”

My, my. That’s quite a precise peg: the coronavirus jumped from animals to humans, for the very first time, between October 30 and November 29, 2019.

No more fake news

They appeared to be of minor concern. The incubation period has not been definitively stated but, once infections began, the spread was surprisingly rapid after the first case was confirmed.

When the outbreak began, the pentagon suddenly began telling it’s soldiers not to use popular Chinese APPs such as TicToc and WeChat…

Apparently the United States military did not want the rank and file soldiers watching locally made videos inside of China. Was it because they hated lip-synchronization and dancing, or something else? Maybe they didn’t want the troops to see the “on the street” Chinese coping with American germ warfare.

One of the victims at Bergen-Belsen was this young woman, her face still bearing the scars of a terrible beating by the SS guards. The military ALWAYS censors the images of war to prevent the troops from getting “soft” towards the “enemy”.
One of the victims at Bergen-Belsen was this young woman, her face still bearing the scars of a terrible beating by the SS guards. The military ALWAYS censors the images of war to prevent the troops from getting “soft” towards the “enemy”.

The initial symptoms were mild, which permitted many people to travel before stronger symptoms were detected.

On December 31, 2019, the World Health Organization (WHO) was informed of an outbreak of “pneumonia of unknown cause” detected in Wuhan City, Hubei Province, China – the seventh-largest city in China with 11 million residents.

As of January 26, there are over 2019 cases of 2019-nCoV confirmed globally, including cases in at least 20 regions in China and nine countries/territories.

The first reported infected individuals, some of whom showed symptoms as early as December 8, were discovered to be among stallholders from the Wuhan South China Seafood Market. Subsequently, the wet market was closed on Jan 1.

The virus causing the outbreak was quickly determined to be a novel coronavirus.

Worst Case: It’s some bio-engineered frankenvirus, with who-knows what lethality, r-naught, and incubation time.

-Woodpile Report

On January 10, gene sequencing further determined it to be the new Wuhan coronavirus, namely 2019-nCoV, a betacoronavirus, related to the Middle Eastern Respiratory Syndrome virus (MERS-CoV) and the Severe Acute Respiratory Syndrome virus (SARSCoV). However, the mortality and transmissibility of 2019-nCoV are still unknown, and likely to vary from those of the prior referenced coronaviruses.

Local medical authorities have said the true extent of the Wuhan coronavirus is unclear, and the early official figures may have been an underestimation since the mild symptoms and delayed onset meant infections may have been undetected.

All the evidence suggests the Chinese authorities acted effectively as soon as they realized the danger they might be facing.

What kind of evil person would unleash such a weapon?

Medical authorities immediately declared the outbreak, and within a week they had identified the pathogen and also determined and shared the genome sequence with the WHO and other parties, a sufficiently speedy response that earned praise from the WHO and scientists around the world.

Chinese treated this seriously.

Remembering the SARS troubles, they did much more.

In most large centers in the country, all sports venues, theaters, museums, tourist attractions, all locations that attract crowds, have been closed, as have all schools. All group tours have been canceled. Not only the city of Wuhan but virtually the entire province of Hubei has been locked down, with all trains, aircraft, buses, subways, ferries, grounded and all major highways and toll booths closed.

Thousands of flights and train trips have been canceled until further notice. Some cities like Shanghai and Beijing are conducting temperature tests on all roadways leading into the cities. In addition, Wuhan is building (in five days) a portable hospital of 25,000 square meters to deal with the infected patients. As well, Wuhan has asked citizens to neither leave nor enter the city without a compelling reason, and all are wearing face masks.

Additionally, the following unique measures are being taken throughout China. This is common in the far North as well as the remote South;

  • Small towns and villages are blocking the roads and not allowing anyone in or out. This is being enforced by the local militia.
  • In cities, the police are walking up and down the streets with bullhorns telling everyone to stay inside and not to leave their homes.
  • A tent hospital has been constructed in Wuhan to handle the cases.
  • A full “regular” hospital is being constructed (in ten days) to handle the problem.
  • A secondary hospital will be built after the construction of the first one is completed.
  • The military, police, fire, and hospital staff all over China are on full alert. Many are working without sleep and rest.
  • After the initial fireworks, everything turned eerily quiet. No one is going outside, no one is traveling, and no one is visiting friends.
  • All major transport hubs are on lock down and temperature screening by CDC attire is the norm.
Individual villages are laying down roadblocks all over China.
Individual villages are laying down roadblocks all over China.

The scale of the challenge of implementing such a blockade is immense, comparable to closing down all transport links for a city five times the size of Toronto or Chicago, two days before Christmas. These decisions are unprecedented but testify to the determination of the authorities to limit the spread and damage of this new pathogen.

CHINA’S HANDLING OF THE NOVELLE CORONA VIRUS INFECTION
Below are comments from Robin Daverman , a American Doctor, expressed in Quora.

Dude, the Chinese government has been exceptionally good in dealing with this virus. You can NOT deliver what the Chinese government has delivered so far, unless you are the mythical Santa Claus.

During the Western African Ebola virus epidemic in 2014, the CDC rushed in to try to find the virus. It took them 2 months from getting the 1st patient sample to identifying the complete genomic sequence, and then another 6 weeks to publish it.

This is Top Urgency, with a virus that has a 90% case fatality rate.

The 2009 Swine Flu in the US, which ended up infecting 55 million Americans and killed 11,000 of them, the first cases started to appear in late March, the CDC identified it on April 17, and the identification kits were not generally available until mid-May. And that was 250 people working 100+ hour a week!

CNY 2020 devistation!

They not only address the gravity of the situation but also the seriousness of consideration for the public health, unfortunate and difficult decisions since the holiday is being destroyed for hundreds of millions of people. Most public entertainment has been canceled, as have tours, and many weddings as well.

The damage to the economy during this most festive of all periods will also be enormous.

Hong Kong will suffer severely in addition to all its other troubles since visits from Mainland Chinese typically support much of its retail economy during this period.

John Bolton quote.
John Bolton quote.

As an aside, I can confirm that no one is going out. Everyone is staying inside. Avoiding others, and all celebrations are either cancelled or muted. It’s really sad.

The Chinese New Year is the most important festival for Chinese. Saturday, January 25, is the first day of the Lunar New Year, a festive period that typically sees the largest mass movement of people on the planet as Chinese flock back to their hometowns to be with relatives. No health authority has ever tackled the challenge currently faced by China, as the country grapples with a new coronavirus just as hundreds of millions prepare to travel.

What kind of evil person would unleash such a weapon?

And of course, the Western media had a field day of schadenfreude. CNN published a report – a bit too gleefully, I thought – on the potential damage to China’s economy:

“China’s economy is slumping and the country is still suffering the effects of the trade war with America. An outbreak of a new and deadly virus is the last thing it needs.

The Wuhan coronavirus has already roiled Chinese markets and thrown plans for the upcoming Lunar New Year holiday into chaos for millions of people. The world’s second-biggest economy grew at its slowest pace in nearly three decades last year as it contended with rising debt, cooling domestic demand and US tariffs, many of which remain in place despite a recent truce.

Beijing is worried about unemployment, too, and has announced a wave of stimulus measures in recent weeks aimed at preventing mass layoffs. . .

The Wuhan coronavirus outbreak could spark widespread fear and spur people to hunker down and avoid going outside. That kind of behavior would deal a huge blow to the service sector, which now accounts for about 52% of the Chinese economy.” [And so on… .]

American media… (shrug)… What can you say?

Meanwhile, in China…

From Asia Times https://lnkd.in/gErEzCe

“the speed of the Chinese scientific response has been breathtaking – and obviously not fully appreciated in an environment of Total Info War. Compare the Chinese performance with the American CDC, arguably the top infectious disease research agency in the world, with an $11 billion annual budget and 11,000 employees.

During the swine flu in the US in 2009 – 55 million infected Americans, 11,000 killed – the CDC took over a month and a half to come up with identification kits.

The Chinese took only 1 week from the first patient sample to complete, vital identification and sequencing of coronavirus. Right away, they went for publication and deposit in the genomics library for immediate access by the whole planet. Based on this sequence, Chinese biotech companies produced validated essays within a week – also a first.”

Point of origin.

The Western media have already staked out their claim to the fundamentals, all media sources claiming the virus was transferred to humans from animals or seafood. None of which has been confirmed as happening.

So you can pretty much ignore the older articles like this one…

The initial reports were dangerously wrong.

It did not originate from a seafood market. Ignore the American mainstream media. They lie, and do so obviously.

The media have added fuel to the fire by claiming the virus emerged from “illegally traded wildlife” in a market “where offerings reportedly include wild animals that can carry viruses dangerous to humans”, and that this virus “jumped into the human population from an infected animal”.

Those reports are also nonsense.

Bio-engineers have confirmed that trans-species “jumping” and mutation of this virus is pretty much impossible.

According to the reports, there would be three kinds of species that would have to be involved. An African cobra, a rare South Pacific bat, and some kind of sea-creature.

Three (3x) species were involved.

We know that 96% of the genome resembles a rare South African bat. We know that “other” DNA from a secondary species is involved, this has tentatively been presupposed to be a cobra. We also know that it somehow mutated to be able to exist within fish or some other kind of sea creature.

Testing at the supposed point of “ground zero” showed high concentrations of this virus within the separate fish tanks throughout the area.So, not only are three species involved, but “somehow” the virus was able to “jump” out of one fish tank and enter others.

And not a snake, something rarer…

The pangolin, a scaly mammalian anteater, is the latest animal to be identified as an intermediate host of the novel coronavirus that has sickened more than 31,000 people worldwide.

According to local media reports, an analysis of genome sequences of viruses isolated from pangolins were a 99% match with those of 2019-nCoV, as the coronavirus behind the epidemic is known. Pangolins are a trafficked, critically endangered species whose scales are believed by some to have medicinal properties.
Scientists at the South China Agricultural University in Guangzhou, Guangdong province in southern China, reported findings Friday from research conducted jointly with the People’s Liberation Army Academy of Military Science in Beijing and the research department of the Guangdong Zoo.

“This has major significance for the prevention and control of the novel coronavirus,” South China Agricultural said in a statement, though it did not elaborate on the research.
While there is general consensus among scientists that the new strain of coronavirus spread from bats to another host before making the jump to humans, previous research pointing to snakes as the culprit has been disputed.

Pangolins Latest Animal Identified as Intermediate Coronavirus Host

Trans-species migration is very rare, but unheard of to involve three species. Especially ones as diverse as the ones being considered.

  • Bat
  • Pangolin
  • Fish

Then it was discovered that the genome contained “HIV insertions”. Thus they discovered that not only is this virus stealthy, contagious and lethal, but it also shuts down the immune systems of the infected person. WTF?

“We found 4 insertions in the spike glycoprotein (S) which are unique to the 2019-nCoV and are not present in other coronaviruses,” the report’s Abstract section states.

“Importantly, amino acid residues in all the 4 inserts have identity or similarity to those in the HIV-1 gp120 or HIV-1 Gag.”

Scientist Explains New Study Revealing Coronavirus May …

These insertions are not random. Their functions, all four of them, are to make the coronavirus very lethal. (Read about it HERE.) Leading world experts in bio-warfare to conclude that this was an engineering pathogen.

It was a bio-engineered, bio-weapon that is intended for mass casualties on a grand scale.

Initially, Chinese officials stated that the virus appears to have originated at a seafood market in Wuhan, though the actual origin has not been determined nor stated by the authorities. This is still an open question primarily because viruses seldom jump species barriers without human assistance.

The odds of this being a natural viral agent is infinitesimally small.

After investigation, the subsequent cases of the illness had zero association with that particular market.

A virus outbreak in the city of Wuhan immediately prior to the Chinese New Year migration could potentially have dramatic social and economic repercussions. Wuhan, with a population of about 12 million, is a major transport hub in Central China, particularly for the high-speed train network, and with more than 60 air routes with direct flights to most of the world’s major cities, as well as more than 100 internal flights to major Chinese cities.

The odds of an accidental release of a bio-weapon inside one of China’s largest cities is infinitesimally small.

When we add this to the Spring Festival travel rush during which many hundreds of millions of people travel across the country to be with their families, the potential consequences for the entire country are far-reaching.

The odds of this event occurring naturally during the CNY eve is infinitesimally small.

Comparison with SARS

This is a novel Coronavirus (2019-nCoV), an entirely new strain related to the MERS (MERS-CoV) and the SARS (SARS-CoV) viruses, though early evidence suggested that it was not dangerous.

SARS was proven to be caused by a strain of the coronavirus, a large family of mostly harmless viruses also responsible for the common cold, but SARS exhibited characteristics never before observed in any animal or human virus, did not by any means fully match the animal viruses mentioned above, and contained genetic material that still remains unidentified – similar to this new coronavirus in 2019.

Virologist Dr. Alan Cantwell wrote at the time that “the mysterious SARS virus is a new virus never before seen by virologists.

This is an entirely new illness with devastating effects on the immune system, and there is no known treatment.”

Military Weaponization of the Virus by America

Dr. Cantwell also noted that the genetic engineering of coronaviruses has been occurring in both medical and military labs for decades.

He wrote that when he searched in PubMed for the phrase “coronavirus genetic engineering”, he was referred to 107 scientific experiments dating back to 1987. To quote Dr. Cantwell:

“I quickly confirmed scientists have been genetically engineering animal and human coronaviruses to make disease-producing mutant and recombinant viruses for over a decade.

No wonder WHO scientists identified the SARS/coronavirus so quickly. Never emphasised by medical news writers is the fact that for over forty years scientists have been “jumping species” with all sorts of animal and human viruses and creating chimera viruses (viruses composed from viruses of two different species).

This unsupervised research produces dangerous man-made viruses, many of which have potential as bioweapons.

Certainly SARS has the hallmarks of a bioweapon. After all, aren’t new biological warfare agents designed to produce a new disease with a new infectious agent? As in prior military experiments, all it might take … to spread SARS is an aerosol can . . .”

Almost immediately upon receiving the genome sequence, several Russian scientists suggested a link between SARS and biowarfare.

No trust in America. But China is considered the most trustworthy nation.
No trust in America. But China is considered the most trustworthy nation.

Sergei Kolesnikov, a member of the Russian Academy of Medical Sciences, said the propagation of the SARS virus might well have been caused by leaking a combat virus grown in bacteriological weapons labs. According to a number of news reports, Kolesnikov claimed that the virus of atypical pneumonia (SARS) was a synthesis of two viruses (of measles and infectious parotiditis or mumps), the natural compound of which was impossible, that this mix could never appear in nature, stating, “This can be done only in a laboratory.”

And Nikolai Filatov, the head of Moscow’s epidemiological services, was quoted in the Gazeta daily as stating he believed SARS was man-made because “there is no vaccine for this virus, its make-up is unclear, it has not been very widespread and the population is not immune to it.”

“…there is no vaccine for this virus, its make-up is unclear, it has not been very widespread and the population is not immune to it.”

Nikolai Filatov, the head of Moscow’s epidemiological services

Russian and Chinese biochemists believe that this virus is man-made.

It wasn’t widely reported, but it seems the final conclusion of the Chinese biochemists was the same, that the SARS virus was man-made.

This conclusion wasn’t a secret, but neither was it promoted to the international media since they would simply have used the claim to heap scorn on China, dismissing this as a paranoid conspiracy theory.

What kind of evil person would unleash such a weapon?

The Western media totally ignored this aspect, except for ABC news who reported that the SARS “Mystery Virus” was possibly “a Chinese bio-weapon that accidentally escaped the laboratory”.

Nice of ABC to notice, but their story, if true, would be the first example of a nation creating and releasing a race-specific biological weapon designed to attack exclusively itself.

Virus is tailored to attack Asians

Notable is that while SARS spread to about 40 countries, the infections in most countries were few and deaths almost zero, and it was exclusively (or almost exclusively) Chinese who were infected, those in Hong Kong most seriously, with Mainland China suffering little by comparison.

The Corona virus is a virus that, for whatever reason, East Asians are susceptible to but other races are not, just like SARS. None of our people are going to succumb to this condition. The MSM’s constant hyping is just a way of making people panic, because people are more susceptible to being indoctrinated when they panic. By not reporting the race of those who have caught this disease in Europe, unnecessary panic is being fomented among Europeans…so that they can be more easily inculcated with the message than “race differences don’t exist, because race is a social construct.”

vDare

The SARS virus apparently much preferred Chinese to Caucasians, though it did attack Vietnamese health care workers (who may be similar to Chinese in their susceptibility).

Outbreak (1995) A dangerous airborne virus threatens civilization in this tense thriller. After an African monkey carrying a lethal virus is smuggled into the U.S., an outbreak occurs in a California town. To control the spread of the disease, a team of doctors is brought in that includes a contagious disease expert (Dustin Hoffman).
Outbreak (1995) A dangerous airborne virus threatens civilization in this tense thriller. After an African monkey carrying a lethal virus is smuggled into the U.S., an outbreak occurs in a California town. To control the spread of the disease, a team of doctors is brought in that includes a contagious disease expert (Dustin Hoffman).

This appears to be precisely the case with this new virus, in that all the infected persons are Chinese. News reports speak of infections appearing in Thailand or the US, but those (at least to date of writing) were all Chinese who had been to Wuhan. There have been no cases so far of infected Caucasians.

As with SARS, this new virus appears to be tightly-focused and race-specific to Chinese.

American bioscientists caught by the police inside of China doing illegal acts.

We might in other circumstances pass this off as an unfortunate coincidence but for some major circumstantial events that serve to alter our focus.

One of these is the history of American universities and NGOs having come into China in recent years to conduct biological experiments that were so illegal as to leave the Chinese authorities enraged.

This was particularly true when it became known that Harvard University had surreptitiously proceeded with experiments in China. Experiments that had been forbidden by the authorities years earlier. And where they collected many hundreds of thousands of Chinese DNA samples and then left the country.

The Chinese were furious to learn that Americans were collecting Chinese DNA.

The government intervened and prohibited the further export of any of the data. The conclusion at the time was that the ‘research’ had been commissioned by the US military with the DNA samples destined for race-specific bio-weapons research.

So the American military was collecting Chinese DNA to develop bio-weapons.

Trademarks and indicators

In a thesis on Biological Weapons, Leonard Horowitz and Zygmunt Dembek stated that one clear sign of a genetically-engineered bio-warfare agent was a disease caused by an uncommon (unusual, rare, or unique) agent, with lack of an epidemiological explanation. I.e. no clear idea of the source.

They also mentioned an “unusual manifestation and/or geographic distribution”, of which race-specificity would be one.

Recent disease outbreaks that would seem to possibly qualify as potential bio-warfare agents are AIDS, SARS, MERS, Bird Flu, Swine Flu, Hantavirus, Lyme Disease, West Nile Virus, Ebola, Polio (Syria), Foot and Mouth Disease, the Gulf War Syndrome and ZIKA.

Outbreak (1995) A dangerous airborne virus threatens civilization in this tense thriller. After an African monkey carrying a lethal virus is smuggled into the U.S., an outbreak occurs in a California town. To control the spread of the disease, a team of doctors is brought in that includes a contagious disease expert (Dustin Hoffman).
Outbreak (1995) A dangerous airborne virus threatens civilization in this tense thriller. After an African monkey carrying a lethal virus is smuggled into the U.S., an outbreak occurs in a California town. To control the spread of the disease, a team of doctors is brought in that includes a contagious disease expert (Dustin Hoffman).

In fact, thousands of prominent scientists, physicians, virologists and epidemiologists on many continents have concurred that all these viruses were lab-created and their release deliberate. The recent swine flu epidemic in China has the hallmarks as well, with circumstantial evidence of the outbreak raising only questions.

Curious questions…

There was another curiosity in this case, in that additionally to the usual criticisms of China being inactive or secretive, several US media replicated accusations from “a senior US State Department official” claiming Washington was “still concerned” about transparency in the Chinese government on the Wuhan coronavirus.

This virus has a long incubation time, and the symptoms appear to be of no concern. Then it strikes suddenly with lethal affect.

Other articles claimed the US CDC was “concerned that Chinese health officials have still not released basic epidemiological data about the Wuhan coronavirus outbreak, making it more difficult to contain the outbreak.”

There is no substantial reason that officials at any level of the US State Department should concern themselves with a virus outbreak in a foreign country.

Their criticisms were surprisingly detailed, demanding specifics on the number of infections directly from contact with the Wuhan market, the number of person-to-person infections, the precise incubation period from exposure to the onset of symptoms, the point at which persons become contagious.

The questions were presented in benevolent terms of helping the Chinese medical authorities deal with the virus, though it was already self-evident China had no need to be lectured on such basics. I must say my sense from reading the articles in question was that the Americans were fishing for something unstated, very possibly the crucial details of their handiwork.

I must say my sense from reading the articles in question was that the Americans were fishing for something unstated, very possibly the crucial details of their handiwork.

As of the date of writing, details are still too scarce to form definitive conclusions but, in every such case, once the smoke clears there are many unanswered questions that challenge the official Western narrative, but it’s old news and the media have already staked out their ground so the matter dies in the Western public mind, but not in China.

Yet, why all this United States propaganda promotion?

As the coronavirus outbreak has come to dominate headlines in recent weeks, several media outlets have promoted claims that the reported epicenter of the outbreak in Wuhan, China was also the site of laboratories allegedly linked to a Chinese government biowarfare program.

However, upon further examination of the sourcing for this serious claim, these supposed links between the outbreak and an alleged Chinese bioweapons program have come from two highly dubious sources.

For instance, the first outlet to report on this claim was Radio Free Asia, the U.S.-government funded media outlet targeting Asian audiences that used to be run covertly by the CIA and named by the New York Times as a key part in the agency’s “worldwide propaganda network.”

Though it is no longer run directly by the CIA, it is now managed by the government-funded Broadcasting Board of Governors (BBG), which answers directly to Secretary of State Mike Pompeo, who was CIA director immediately prior to his current post at the head of the State Department. (How dubious, coincidence ??? – my view)

-LinkedIN Anonymous

The Argument

Given the multiple and serious woes that China has suffered from during 2019, it comes as no surprise that the Western powers would continue to suppress China in an effort to regain global dominance.

  • HK “pro democracy” riots fully funded and instigated by the NED / CIA.
  • Swine Flu decimated the vast bulk of the Chinese pork industry.
  • Bird Flu decimated huge numbers of the Chinese chicken industry.
  • NED support and training of Uyghur Muslim extremists.

If there’s one last hit to the economy that China doesn’t need right now, it’s a global pandemic that ‘supposedly’ originated in Wuhan.

Wuhan is the capital of Central China’s Hubei province (see map below with the red marker identifying Wuhan). For those of you who are unaware, Wuhan is located right in the center of China’s highly productive southeast region—the economic powerhouse of the nation.

Map showing where Wuhan is located inside of China.
Map showing where Wuhan is located inside of China.

This strategic location is an ideal location to launch a biological attack because of the easily engineered vectors of disease dissemination. After all, isn’t that a staple of Hollywood Science Fiction movies like 12 Monkeys (1995)?

Scene from “12 Monkeys”. In a future world devastated by disease, a convict is sent back in time to gather information about the man-made virus that wiped out most of the human population on the planet.
Scene from “12 Monkeys”. In a future world devastated by disease, a convict is sent back in time to gather information about the man-made virus that wiped out most of the human population on the planet.

The idea of paralyzing China’s economic and financial sectors is, after all, a primary goal of this essentially Anglo-American black operation.

Long Incubation Phase

The main concern for nCoV-2019 is relatively extended incubation phase of the virus, which can last from 5 to 14 days, during which a person is contagious. Moreover, there is already evidence of clinically silent cases (no symptoms), which will make prevention even more challenging.

In any case, full-scale quarantine to cope with Wuhan crisis seems to be a legitimate measure, supported both domestically and in the international community.

In light of the[1] US-staged Hong Kong protests,[2] U.S. tariff regime against China,[3] threat of economic sanctions against nations working with Huawei,[4] CIA-inflamed Xinjiang conflict involving the Muslim Uyghurs,[5] provocative sailing of US Navy warships through the Taiwan Strait,[6] transparent political prosecution of Huawei’s CFO, and the[7] ravaging of China’s pig farms by a bioengineered virus, etc., the Chinese government has been under withering attack since 2018.

When so many debilitating assaults are suspiciously happening at once, what can China do?

SARS conspiracy theory

The original SARS pandemic that took place in China after the turn of the millennium was also well-known in bio-medical circles as a naked act of biowarfare.

Like this year’s coronavirus bio-attack in Wuhan, the bioengineered SARS outbreak also involved a highly coordinated campaign of propaganda and disinformation.

However, the administration of Xi Jinping is much too concerned about the panic that would inevitably result if the populace was informed of a full-blown bioweapon attack.

The precipitating chaos would simply overwhelm the government in Beijing which is already on serious overload because of the seemingly endless interference by the Anglo-American Axis.

The SARS outbreak that occurred from 2002 to 2003 has already shown that China is not willing to release the hard scientific evidence that proves the existence a bioengineered coronavirus. This favors the antagonists.

The following excerpt from Wikipedia explains some of the background of SARS—the Severe acute respiratory syndrome epidemic that took place primarily in mainland China and Hong Kong, but also in Canada and other countries.

SARS Conspiracy theory.
SARS Conspiracy theory.

Excerpt from SARS conspiracy theory

Wuhan Coronavirus of 2020

The rapidly spreading Wuhan coronavirus, also known as Novel coronavirus, that was first reported in 2019 has all the hallmarks of yet another bioengineered virus in a U.S. Military laboratory.

What follows is a short description form Wikipedia of this Novel coronavirus (2019-nCoV).

Wikipedia on this Novel coronavirus (2019-nCoV)
Wikipedia on this Novel coronavirus (2019-nCoV)

Time will tell whether this deadly coronavirus was released into the Chinese population with the intent to kill and sicken, scare and intimidate. We really do not know what the actual purpose was.

However, given the lethal nature of this viral agent, the history associated with the American bio-weapons engineering, and public statements made by American neocon leaders, can can pretty much guess the intention;

Complete and utter devastation of the Chinese population and the collapse of the Chinese government.

The intimidation phase of such an ongoing black operation is certainly aimed at the government in Beijing which refuses to be coerced and threatened by the Trump administration.

This virus has a long incubation time, and the symptoms appear to be of no concern. Then it strikes suddenly with lethal affect.

Because the highly disruptive, Western-backed Hong Kong protests have yet to yield the result desired by the U.S. State Department, it was only a matter of time before the C.I.A. implemented Plan B…

…or is this Plan C?

…or D?

Why China?

The $64,000 question here is: Why is China always the epicenter for so many strains and variations of coronaviruses, influenzas, pneumonia viruses and other highly contagious infection agents that strike the major commercial centers on southeastern mainland.

What’s particularly suspicious about all of these outbreaks in China is that they are each described by the Mainstream Media as quite dangerous to human health. The mortality rate in the beginning of these eventual pandemics is especially high, as if by purposeful design of the bioengineers.

In this way, the whole world is eventually drawn into a pandemic melodrama that’s certainly designed to fear-monger.

Hence, more of these endless distractions serve the specific purpose of taking the attention away from real problems caused by governments everywhere. But it’s the numerous criminal conspiracies at work and shocking scandals that the elites seek to cover up by any means possible.

There are relatively few military bioweaponry labs in the world that have the capability to create such a fatal and infectious virus.

Thus, when the truth is confirmed about the Wuhan flu, there will be only a few culprits who are behind these assaults against the Chinese people. In reality, should this Wuhan coronavirus outbreak become a full-blown epidemic in China it could represent an attempt to commit genocide.

Likewise, if it becomes a bona fide pandemic, it could ultimately be labeled a crime against humanity.

“It’s really quite easy for any of the numerous U.S. military bioweapon labs to bioengineer a deadly super-virus and then release it in a city as large as Wuhan, China.

Acts of bioterrorism like this are carried out all the time. As a matter of historical fact, the Spanish flu pandemic of 1918 actually originated at Fort Riley, Kansas where soldiers reported to the Army’s largest training facility during World War I.

The soldiers who were [DELIBERATELY] infected with the H1N1 influenza virus then served as countless vectors of dissemination for the pandemic that ultimately killed as many as 100 million people worldwide. That single US-executed biowarfare operation against humanity was arguably the deadliest depopulation event in human history.”

(See: Spanish Flu of 1918 Was Really a Bioterror Attack on Humanity)

THE DARK SIDE

This is from UNZ, a great website, worthy of visiting.

  • Since the 20th century, the West has been and continues to be the most avid users of bioweapons. The United States is the biggest user of biochemical weapons in history, including in Cuba; Iraq, Syria and Iran (by proxy); Serbia, Japan, Vietnam, Laos and Cambodia, and America has eagerly used them on its own people, apparently more often than we care to admit.
  • In the 1940s the United States purposely infected thousands of Guatemala, natives with syphilis and gonorrhea, to test these human guinea pigs with antibiotics. Of course, these suffering souls were sexually active for the rest of their lives and unwittingly infected everybody they came in contact with, including spouses.
  • At Tuskegee, hundreds of American blacks were allowed to carry syphilis from the 1930s to the 1970s, to act as human petri dishes. This was to track the progress of the disease and observe the eventual macabre deaths that this bacteria is wont to inflict on its victims, in its final stages: insanity, nervous disorders, liver and heart disease.
  • The United States has a long, illustrious history of using bioterrorism around the world. Cuba has been a favorite target and has seen hundreds of thousands of its people infected with Dengue fever as well as its entire swine herd wiped out by swine fever.
  • T he United States of America holds the exclusive patent on the Ebola virus: US patent number 20120251502, is owned by the American government. Ebola has been Uncle Sam’s bioweapon plaything since 1976, when it was discovered in Zaire and shipped 3,500km by America’s bio-warfare lab at Fort Detrick, Maryland, then to West Africa for cultivation and development (via the UK’s bio-warfare labs in Porton Down and with the help of the World “Health” Organization), specifically, to Liberia, Guinea and Sierra Leone, the current epicenters of the Ebola epidemic on the Great Continent.
  • The 2014 Ebola outbreak came as a result of another rogue US Military operation in austral Africa from which the Soros/Gates-funded Kenema bioweapons lab in Sierra Leone was involved.
  • The US has a long history of biowarfare against China. The Report of the International Scientific Commission for the Investigation of Facts Concerning Bacteriological Warfare in Korea and China (ISC report) validated claims by North Korea and China that the US had launched bacteriological warfare (biological warfare, BW) attacks against both troops and civilian targets in those two countries over a period of months in 1952. This 667 page truth commission report has the dubious distinction of being the most vilified written document of the 20th Century. The report’s release in September 1952 brought a withering international attack. It was roundly denounced by American and British politicians of the highest rank, ridiculed by four star generals, accused of fraud by celebrated pundits, misquoted by notable scientists, and scorned by a compliant Western press. In subsequent decades, volumes placed in American university library collections were quietly and permanently removed from circulation. When the rare copy came up for auction, it was discretely purchased and disappeared from public view.
  • In March 2019, in a mysterious event, a shipment of exceptionally virulent viruses from Canada’s NML biological labs ended up in China. Canadian officials say the shipment was part of its efforts to support public-health research worldwide. They claimed that it was just normal procedure. What is unclear is why it was done in secret, and why the Chinese officials lodged a complaint. For certain, if this was just a routine transfer, the Chinese government would have been notified. In July 2019, a group of Chinese virologists were forcibly dispatched from the Canadian National Microbiology Laboratory (NML). The NML is Canada’s only level-4 facility and one of only a few in North America equipped to handle the world’s deadliest diseases, including Ebola, SARS, Coronavirus, etc.
  • On October 18th, 2019, the Johns Hopkins Center for Health Security, in conjunction with the World Economic Forum assembled “15 leaders of business, government, and public health” to simulate a scenario in which a coronavirus pandemic was ravaging the planet. Major participants were American military leadership, and certain neocon political figures. The Chinese were not invited. The members took notes, and then returned to their day to day operations.
  • In Simulation Run 3 Months Ago, the Bill and Melinda Gates Foundation Predicted Up To 65 Million Deaths Via Coronavirus.
  • 300 US military personnel arrived in Wuhan for the Military World Games on October 19. The first coronavirus case appeared two weeks later, on November 2. Coronavirus incubation period is 14 days.
  • Two months later a very similar coronavirus pandemic hit China at Wuhan, a major transport hub in Central China and for the high-speed train network, and with 60 air routes with direct flights to most of the world’s major cities, as well as more than 100 internal flights to major Chinese cities right at the Spring Festival travel rush when hundreds of millions of people travel across the country to be with their families.
  • The Coronavirus (2019-nCoV) is an entirely new strain related to the MERS (MERS-CoV) and the SARS (SARS-CoV) viruses, though early evidence suggested that it was not dangerous. SARS was proven to be caused by a strain of the coronavirus, a large family of mostly harmless viruses also responsible for the common cold, but
  • SARS exhibited characteristics never before observed in any animal or human virus, did not by any means fully match the animal viruses mentioned above, and contained genetic material that still remains unidentified – similar to this new coronavirus in 2019.
  • SARS had the hallmarks of a bioweapon. After all, aren’t new biological warfare agents designed to produce a new disease with a new infectious agent? As in prior military experiments, all it might take … to spread SARS is an aerosol can . . .” Several Russian scientists suggested a link between SARS and biowarfare. Sergei Kolesnikov, a member of the Russian Academy of Medical Sciences, said the propagation of the SARS virus might well have been caused by leaking a combat virus grown in bacteriological weapons labs. According to a number of news reports, Kolesnikov claimed that the virus of atypical pneumonia (SARS) was a synthesis of two viruses (of measles and infectious parotiditis or mumps), the natural compound of which was impossible, that this mix could never appear in nature, stating, “This can be done only in a laboratory.” And Nikolai Filatov, the head of Moscow’s epidemiological services, was quoted in the Gazeta daily as stating he believed SARS was man-made because “there is no vaccine for this virus, its make-up is unclear, it has not been very widespread and the population is not immune to it.”
  • Virologist Dr. Alan Cantwell wrote at the time that “the mysterious SARS virus is a new virus never before seen by virologists, “This is an entirely new illness with devastating effects on the immune system, and there is no known treatment.” Dr. Cantwell noted that the genetic engineering of coronaviruses has been occurring in both medical and military labs for decades. When he searched in PubMed for the phrase “coronavirus genetic engineering”, he was referred to 107 scientific experiments dating back to 1987. To quote Dr. Cantwell: “I quickly confirmed scientists have been genetically engineering animal and human coronaviruses to make disease-producing mutant and recombinant viruses for over a decade.”
  • The virus outbreak coincides with the trade war on China.
  • The virus outbreak coincides with the HK “pro democracy” riots fully funded and instigated by the NED / CIA.
  • The virus outbreak occurred just after Swine Flu decimated the Chinese pork industry.
  • The virus outbreak occurred just after Bird Flu decimated the Chinese chicken industry.
  • The virus outbreak occurred just before NED support and training of Uyghur Muslim extremists.
  • This month, CNN published a gleeful (and untrue) report, “China’s economy is slumping and the country is still suffering the effects of the trade war with America. An outbreak of a new and deadly virus is the last thing it needs.”

What will America do next?

  • Nuclear plant meltdown?
  • Mysterious deaths in the Chinese leadership ranks.
  • Armed fighting in Taiwan?
  • Collapse of a dam?
  • Sinking of cargo ships?
  • Mysterious disappearance of a passenger plane or ship?

Do not be under the mistaken assumption that America will stop, or that China will continue to accept this status quo. It can only proceed so long before all fucking Hell breaks loose.

I’ve said this over and over … please listen for once.

Americans have no FUCKING idea how bad things can get. Do not believe that fighting for “Oligarch ruled global democracy” is worth the ultimate “push back”.

Contrary Opinions

I do not have all the answers. All I did was sleuth though public, but forgotten articles, and stung things together into a thesis. There are other opinions, of course.

[1] It’s natural, but the bad timing is coincidental.

Of course, this theory omits a number of “elephants in the room”.

[1] These markets date back 5000 years. Why would there be an out break now? Why not during the time of King Nebuchadnezzar?

[2] If it is natural, then why would the United States patent it?

[3] Why are all these viral outbreaks against Chinese people and livestock? Why nothing else? Why no dogs and cats, donkeys and horses and birds? Why so darn selective?

[4] Why Wuhan; the geographic nexus of the Han race? Why not Guangzhou which is bigger, has more such markets, and has a year-round environment that is conducive to viral growth?

[5] Species jumping is rare. Tri-species jumping is unheard of, and the HIV inserts are not a natural occurrence.

To accept this narrative, you must also accept that the world is filled with coincidences that should not be explained.

Additionally, it’s not “so bad” or “so dangerous”. Here’s a chart that I found on a conservative web site called MoA;

The Wuhan virus is not that dangerous. It’s all just a lot of hype.
The Wuhan virus is not that dangerous. It’s all just a lot of hype.

To agree with this assessment then you must accept the idea that the Chinese government are idiots and over-reacting.

[2] It’s a biological weapon, but it’s China’s fault. They stole it from the USA and accidentally released it.

This narrative accepts the idea that the virus is man-made. However, it argues that the Chinese are not smart enough to develop weapons on their own, and are too inept to handle them.

The Chinese are the most merit-driven people on the world. This is true whether they are in school or working in a company. This narrative is something that does not fit with any Chinese that I know about. It’s like that narrative the Trump hired low-class strippers and asked them to pee on a hotel bed. You might not like Trump, but this does not fit his personality.

[3] It’s a biological weapon, but it’s China’s fault. They had a biological weapons lab in the middle of one of the largest centrally located Chinese cities and it somehow escaped.

The facility in Wuhan is NOT a military or development facility. It is a civilian diagnostic facility.

The difference between a military development facility and a public diagnostic facility is stark. It is the difference from a factory that makes automobiles, and a local automotive service center.

“One of the goals was to build a BSL-4 laboratory that meets the national and international standards for diagnosing, researching, and developing antiviral drugs and vaccines while additionally preserving highly pathogenic BSL-4 agents for future scientific research.”

It is a diagnostic facility. It is used to develop antiviral drugs. Read for yourself.

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6478205/

Civilian viral research facilities are registered with the UN. Here is a List of BSL-4 Facilities.

https://www.liquisearch.com/biosafety_level/list_of_bsl-4_facilities

Military viral research facilities are secret. While in the United States there MIGHT be some shared use facilities, I remain very skeptical about that concept. Knowing what I know about severely classified programs, it’s just not going to happen.

There is a fundamental difference between top-secret military warfare development, and civilian diagnostic facilities.

Military facilities do not need to be registered with any agency. Certainly, unless specified by treaty, military development complexes are not identified as they operate outside the public domain. You will notice that no North Korean labs or facilities are listed, nor are any Chinese military facilities.

If the Chinese were developing a militarized viral agent, they would not use a monitored diagnostic facility. They would use a classified military base, and they would not advertise it’s location. It would be in one or more of these facilities…

https://www.globalsecurity.org/military/world/china/army-fac.htm

What most people do not understand is that most of the “dirty global politics” that this Wuhan event signifies occurs outside the public domain. Like the movie “Men In Black”, the public is kept ignorant intentionally. In America that is why there are Special Access Programs, and branches that are “waived” and “unacknowledged”.

Now, all that being said, the argument against an accidental release from the BSL-4 Wuhan facility is that it is a new viral agent. It’s new. It’s militarized.

It cannot come out of a diagnostic facility.

That’s silly. That’s like asking your local automobile clinic down the street to build you a new car with custom details and new type of engine and custom transmission. Silly.

Comparison between the Wuhan diagnostic facility and an American R&D weapons facility. Note the difference in the number of buildings, the campus size and distance from public roads.
Comparison between the Wuhan diagnostic facility and an American R&D weapons facility. Note the difference in the number of buildings, the campus size and distance from public roads.

And…

Editors’ note, January 2020: Many stories have promoted an unverified theory that the Wuhan lab discussed in this article played a role in the coronavirus outbreak that began in December 2019. Nature knows of no evidence that this is true.

Inside the Chinese lab poised to study world’s most dangerous pathogens

And of course, you have my conclusion…

Conclusion

America is waging biological warfare with China.

This time, it was really, really serious. Far worse than what started World War I, and World War II.

It is being done without an Act of War, and Congressional approval.

Luckily China took immediate steps, but the net-citizens, the world, and the people of Asia are on alert.

This is very, very dangerous, as the moment it is proved, both China and Russia will be forced to retaliate. Their people will not tolerate passive acceptance of a WMD attack on their nation.

It does not matter if it is nuclear, chemical or biological. It will not be permitted to pass without consequence.

For there HAS to be some consequences. If there isn’t any, things will only get worse.

Who ever thought this up was pure evil. It follows the same story-line as the movie “12 Monkeys” where a a bio-weapon was released directly in front of the Christmas holiday in all the major cities of the world.

Not only was the Wuhan coronavirus surreptitiously disseminated to serve as a major distraction from a rapidly collapsing Global Economic & Financial System

…this state-sponsored black operation also represents the worst of predatory capitalism conducted as a means of generating revenue.

It occurred and peaked during the one most important day in the year in China; CNY eve. The odds of this occurrence being natural is rather small.

Look at the dissemination and propagation visually.

Look at the dissemination and propagation visually.
Look at the dissemination and propagation visually.

In China, CNY eve is roughly equivalent to a combination of Christmas eve, the fourth of July and Labor day. This is THE most critical time of the year for the Chinese people. It is a time when the “great migration” begins and everyone returns home. And there are many many public and private parties. It’s a time when drunken buddies hug each other splash alcohol all over each other and spend times with everyone. It is a time where everyone is interacting with everyone else.

The odds of this happening is 1 in 365.

Think about that! A release of a bio-weapon when the vast majority of Chinese are traveling and enjoying time together at parties.

What kind of evil person would unleash such a weapon?

Meanwhile, the narrative that this is an escaped bio-weapon is being heavily promoted by the Indian mainstream media (an individual funded by grants by an American institution). As well as some Australian news and opinion pieces (also funded by American interests).

Except, for one thing…

The bio-warfare labs are located in Xinjiang. Not in Wuhan… a city more than twice the size of New York City.

If you want to believe that a bio-warfare development lab is placed in a major city, then I have a bridge to sell you. No nation, especially not one run by merit, will put such a dangerous and lethal development center in the middle of such a large and important city.

Key Points…

American military members apparently unleashed an American patented, and Canadian engineered Biological Weapon in the major city of Wuhan designed to coincide with the yearly CNY mass migration. We know their names, and where they stayed and their actions. ALL Chinese cities are wired with video recording systems pipe-lined to the local police.

Like HK was able to record the Trump Administration cutting deals with separatist radicals, the Chinese have full documented evidence of what occurred.

China is now coping with this situation.

Once the situation settles, China will continue with negotiations with the soviets in Russia. They will conspire on a solution to reduce or to protect Asia from the American “pro democracy” internationalism.

All Americans should take note. Nothing ever goes unpunished.

Lastly, the timing of the deadly virus that ravaged China’s pig farms last year quite predictably triggered a call for the development of a preventative vaccine. What the following news report neglected to state was that the mass slaughter of pigs, in a society that demands LOTS of pork, was cynically planned to manufacture the urgent need for yet another vaccine.

The bottom line here is that the Wuhan coronavirus is likely a race-targeting bioweapon strategically unleashed throughout China by U.S. military labs

On a personal note…

There are various comments sent to me by enraged readers. They do not like what I have written.

I do not post comments I do not approve up. This is my blog and I am God here.

They claim that I am America-bashing and that all that I am saying is an attack on the great American “democracy”. They argue that China is a Communist Dictatorship (it isn’t, it’s a Republic nearly identical to the setup in America in 1776), and that everything I write is a lie.

I am an American expat. I am also a former Navy “brown shoe” and as patriotic as can be. Check out my other SHTF posts. I am a proud gun-toting, Trump loving “deplorable”.

The desire for the United States to maintain it’s grip on the world should not be in question. That is understandable. What should be, however, is how it is being handled.

You should not try to raise yourself up by pushing others down.

This course that the United States is on is dangerous and fool-hardy. I worry that it will eventually result in a “push back” that America, the nation that I love, can never recover from.

I know things that most average Americans do not know. DO NOT PLAY AROUND WITH THE THREAT OF DANGER. It’s foolish.

Be careful in your actions.
Be careful in your actions.

When I was in High School I used to hang out with my friends and go to parties in the woods. We called these events “keg parties” and it was an every night affair. However, sometimes people would drink too much and insist on driving.

They were our friends, and buddies that we loved and cared about. But, things being as they were, eventually the sloshed friend would end up behind the wheel.

The others, with no other way to get home would be trapped in this death machine as our drunk buddy drove all over the road and in and off it. We were trapped while the good-meaning but absolutely incapable friend risked all of our lives.

That is what is going on… RIGHT NOW… in the United States.

Chinese messaging all over Wechat

The following is a message from the government of China to everyone. Read it. The Chinese government is treating this as a major event similar to that of a war. Read the translation and come to your own conclusions.

The Chinese…

什么叫“一级响应”?

一级响应是国家在面临战争和重大灾难时的最高应对级别。2003非典都没有启动一级响应;2008年汶川地震死了十多万人也没有启动一级响应。这次浙江、广东率先启动一级响应、现全国启动了一级响应——这说明事态的严重性远远超出人们最大胆的想象。因此提醒大家千万不能等闲视之。能让武汉封城、北京所有庙会取消、上海迪斯尼关闭、贺岁电影全部下架、全国戒备百城空港!!疫情一定严重到超乎我们的想象了!请放下盲目自信… 请照顾好自己和家人,对自己和家人朋友负责!好好守在家里,安全度过这场大灾难!

再次普及:这是战争不是儿戏,打赢了,天天都是春节!输了,这就是你最后一个春节!收起你盲目的自信和侥幸心理,也收起你事不关己高高挂起的态度,这场战役没有局外人!呆在家不要外出!保护的是你自己!是对全家人的负责!对一线的医护人员负责!对社会的负责!

The translation…

What is a first response?

The first-order response is the highest level of national response in the face of war and major disasters. None of the 2003 SARS initiated a first-order response; Wenchuan earthquake in 2008 killed more than 100,000 people did not start a response level.

This time, Zhejiang and Guangdong took the lead in initiating the first-level response, and now the whole country has launched the first-level response.

This shows that the seriousness of the situation is far beyond peoples boldest imagination.

Therefore, we must not take it lightly.

Can let Wuhan Fengcheng, Beijing all temple fairs canceled, Shanghai Disneyland closed, New Years film all off shelves, national guard hundred cities airport!!

The outbreak must be worse than we thought!

Please put down your blind confidence. Please take good care of yourself and your family and be responsible for yourself and your friends.

Stay at home and ride out this disaster safely!

Once again popular: This is war is not a game, win, every day is the Spring Festival! Lose, this is your last Spring Festival!

Put away your blind self-confidence and luck, but also put away your attitude that you have nothing to do with yourself, there is no outsider in this battle!

Stay at home and don’t go out!

You’re protecting yourself!

Is responsible for the whole family!

Responsible for the front-line medical staff!

Responsibility to society!

The way that China is treating it differs substantially from the way the American and British mainstream media is reporting it.

The American mainstream media is completely out of touch. A nation with a population many times that of the United States locks down everyone inside their homes for three weeks, and this is NOT news? It’s like the flu? Only not as bad?

What.

The.

Fuck?

So the flu is far deadlier than this?

Chinese Government releases are curious statement…

Just now, the Chinese government has sent a message to everyone NOT to TRAVEL during the NEXT holiday sometime in April. That’s four months in the future…

Why?

What do they know?

Take Aways

 

  • American / Canadian bio-weapon scientists have engineered similar germ-weapons; of the same type, the same class, and the same nearly identical properties.
  • We know this because they have filed patents on this viral type with the United States patent office.
  • [1] Canadian bio-weapons scientists were caught “red handed” trying to sneak a similar Cat-4 viral pathogen into China in March 2019. The Chinese government lodged a complaint.
  • [2] American bio-scientists have also been caught “red handed” collecting Chinese DNA for their biological experiments.
  • Both events are well documented, and formal complaints by China have been lodged.
  • The profile, characteristics of this strain are are indicative of a bio-weapon. Especially the stealth nature of contamination, the deceptive nature of transmission, and the sudden and fatal results. All are hallmarks of a militarized biological weapon.
  • The launch of this sickness occurred at a time and place indicative of a biological attack. The odds of this occurring randomly is small.
  • Neocon John Bolton attended a high-level discussion with the Gates foundation about the transmission of a biological pathogen two months before this event.
  • Since 2018 the Chinese at all levels, have been “closed out” of American and “allied” biological weapons research, and pandemic studies.
  • American military personnel were in Wuhan at the precise moment of the first release of the virus.
  • Then all military staff were directed NOT to watch Chinese social media applications, videos and photos.
  • Chinese authorities are acting swiftly and proactively. They are not pointing fingers, or laying accusations.
  • However, the Chinese government and their military are treating this as a biological attack.
  • American mainstream media is treating this as a harmless flu.

Other thoughts…

There are some 100-plus CIA / Pentagon-sponsored clandestine and semi-known laboratories spread throughout the world – laboratories to fabricate and test agents for biological warfare.

A few years ago, one such laboratory was discovered and reported on in Ukraine. They were working on a virus affecting the “Russian Race”. Since there is no homogenous Russian Race – their initial trials supposedly failed. Since the empire never gives up in its evil attempts to dominate the world, we can assume that research on race directed bio-agents continues.

This western, especially American (CIA, Pentagon, NATO) project to develop biochemical weapons to kill people by disease rather than bullets and bombs – it is much cheaper! And less obvious – does exist.

You may draw your own conclusion on whether SARS and the new 2019-nCoV fits that pattern. The timing of the appearance was especially curious. It was first reported on 31 December 2019 in Wuhan – and then expanded into a proportion, so that it interfered with China’s most important holiday, the Lunar New Year. It could, of course, be just coincidence.

One of Washington’s “low-grade” warfare models is destabilizing China (and Russia for that matter) with any means. With the objective of destabilization, China is constantly being harassed and aggressed – see Hong Kong, Taiwan, the Uyghurs in Xinjiang, Tibet, the tariff wars – and why not with a contagious virus, a trial for a potential pandemic?

What can be observed and even the west must notice to their chagrin and frustration – is China’s extreme resilience and capacity to adapt and resist – to resist with powerful minds and ingenuity that saves her people. And that without counter-aggression, without even an accusation and never a threat.

This is China’s way forward: a steady flow of endless creation, avoiding conflict, no dominance, but seeking harmony by building bridges between people and among countries and cultures – creating understanding and wellbeing, towards a multi-polar world. A model for mankind? – If only the west would open its eyes and wake up.

The Coronavirus Epidemic: Chinese Resilience and Silent, Simple and Steady Resistance – A Model for Mankind

Why is America doing this?

Why America is doing this…

The actual trade imports that China obtains from the United States. One of the often cited misconceptions that many Americans have is that China would collapse if the United States were to stop trading with her. The idea is that "China needs us more than we need them". It’s not true, and it’s not even remotely true. Here, is the actual import data that China imports from the United States. Take a good long hard look at it.

And the American government wants China to be reduced, they are openly announcing their glee that Chinese people are hurting…

Yeah. As if America still had factories that can employ skilled people, as well as still had people that had the ability to manage and supervise factories…

I just do not trust the USA government.

General trust.
General trust.

Update 1

Coronavirus: The Plot Thickens
From Reports:

Indian researchers have found HIV-derived inserts in the coronavirus genome that compound the infectious potential and greatly bolster the argument this virus was developed as a bioterror weapon. https://www.zerohedge.com/geopolitical/coronavirus-contains-hiv-insertions-stoking-fears-over-artificially-created-bioweapon

This 2016 Worldwide Threat Assessment of the US Intelligence Community lists China as a major potential “terror actor” (p.2) and genome editing (p.9) as a major terror risk. https://www.dni.gov/files/documents/SASC_Unclassified_2016_ATA_SFR_FINAL.pdf

Before jumping to conclusions, let’s assume for argument’s sake that the paper published in India on the makeup and likely evolution of this virus passes peer review. What then? The international community will likely conclude the virus was bio-engineered and will condemn China with major implications for sanctions and global trade/travel.

But consider: it is the agenda of USA to contain the rise of China. Cui bono?

Is it far-fetched that having fingered China as a major terror actor and terror risk that US agents would have created this epidemic in the epicenter of Chinese virology experimentation?

It is easier in this instance to identify the crime than the criminal. Western intel agencies are associated with false flags.

Coronavirus: The Plot Thickens

Update 2

Apparently, people are actually dying in the streets. WTF?

Do not let the soundtrack fool you. This is serious business.

And this…

Dead in the streets being attended to.
Dead in the streets being attended to.

Update 3

Americans to the rescue!

The holiday started on CNY eve, and ended just as abruptly when the government ordered everyone to stay inside. Now, on the eve of the first day of work after the holiday we get this message floating around Chinese social media…

重磅利好!!! 古利得是一家非常牛逼的美国研究病毒药物的公司,在世界上没有几家,它研究的一些药物是当今世界上没有的。这次中国请来的研究病毒的专家就是这个公司的老总,钟南山院士亲自去机场迎接接他!因为这个公司的抗病毒药瑞德西韦治好了中国武汉去美国的35岁患者,所以中美已经签订合同购买这个公司抗病毒的瑞德西韦进口协议!这个抗病毒特效药今天已经到了中国!明天就会用到武汉的病患者身上了!!!重要的是用药以后,一天就可以好转!很快局面就会转好了!那些重病人都有救了!

Translation…

Big Benefit!!!

Gullit is a very powerful American company that studies viral drugs. There are few in the world, and some of the drugs it studies are not available in the world today.

This time the expert that China invites to study virus is this companys boss, academician Zhong Nanshan goes to airport personally to meet him!

Because the companys antiviral drug Red Seaway cured 35-year-old patients from Wuhan, China to the United States, China and the United States have signed a contract to buy the companys antiviral Red Seaway import agreement!

This anti-virus medicine has arrived in China today! Tomorrow will be used in Wuhans patient body!!!

The important thing is that after you take the medicine, you can get better in a day! It will all turn around soon! The seriously ill are saved!

I do not know if this message is true or not. Typically, the Chinese tend to be very pragmatic, they usually don’t post hoaxes or lies. It can land them in a Chinese gulag if they do.

Imagine that, if true!

An[1] American company, suddenly has the[2] cure, and it’s a miracle cure! It works nearly[3] instantaneous! The world is saved, and it’s the Americans who did it.

Well… we will see.

In the world of politics, and global diplomacy it’s a high stakes game of push, thrust, parry, retreat, fancy foot work, and parry.

  • The idea that it is isolated to far away China only, and that it’s not so bad as the flu is falling apart.
  • With the alternative media promoting the idea that this is a bio-weapon stolen by the Chinese and released accidentally …
  • … and Tictoc and Chinese social media showing men, women, children and complete families, dressed like Americans, dying on the street…
  • And the American military being forbidden to watch this.
  • And the very non-confrontational (smiling and nodding) Chinese reaction…
  • While China and Russia are having meetings…

Perhaps, it’s time for the USA to pull back from this operation.

We will see.

All I do know is that according to the American mainstream news, “China has not accepted help from America”, from the article titled “China has not yet accepted US help with the coronvirus epidemic “. This article is what the White House adviser Robert O’Brien has to say.

Update 4

Turns out the news in Update 3 about the medicine was out of Thailand, not the United States. Thailand did the research. The United States just owns the drug that the studies were based upon.

Today 5FEB20, Beijing has released a statement;

著名的北京中日友好医院曹彬医生团队在疫情发生后,通过一系列研究在2月3日凌晨起对瑞德西韦(Remdesivir)进行了临床试验证明,结果显示效果良好!——

用药以后17个小时,就恢复了96%的肺功能!到2月4日,所有参加临床试验的270名病人的肺部功能都正在恢复!

Translation;

After the outbreak, the team of Dr. Cao Bin of the famous Beijing Sino-Japanese Friendship Hospital conducted clinical trials on Remdesivir in the early hours of February 3rd through a series of studies, which showed good results! ——

Within 17 hours of the drug, 96% of the lung function was restored! By February 4th, all 270 patients who participated in the clinical trial were recovering their lung function!

The second part of this report reads…

而且,前天泰国传来的大消息,也佐证了该药物的有效性!

12小时好转!48小时就由阳转阴!

2月2日14:00,泰国副总理阿努廷公布了泰国在当前治疗新型冠状病毒肺炎的进展——使用艾滋病压制治疗药物及抗流感病毒两大组合疗法,重新制定出新式医疗方案

治疗结果显示,在该医院接受该疗法的新冠肺炎病例,在12小时后病情好转,48小时检测结果为阴性。

来自武汉的患者已经70多岁,到Rajavithi医院的时候,肺部炎症情况已经十分严重,肺部充血,需要借用设备辅助呼吸,并且患者本身有高血压及心脏病等随身疾病史,综合来看,该患者感染情况属于较为严重一列。

泰国医疗专家组,通过综合考虑及临床实验等,通过HIV抗逆转录病毒药物与抗流感药物联合给药的方案:每天早-晚服用HIV抗逆转录病毒药物,同时每天早-晚服用抗流感病毒奥司他韦Oseltamivir,病人竟然全面退烧!

Translation…

Moreover, the big news from Thailand the day before yesterday also confirmed the effectiveness of the drug!

12 hours to get better! 48 hours from yang to yin!

On February 2nd, at 14:00, Thai Deputy Prime Minister Anutin announced Thailand’s progress in the current treatment of the new coronavirus pneumonia – the use of AIDS-suppressing drugs and anti-flu virus two combination therapies, to re-develop a new medical program.

The results showed that the hospital received the treatment of the new case of coronary pneumonia, after 12 hours of improvement, 48 hours test results were negative.

Patients from Wuhan have been more than 70 years old, to Rajavithi Hospital, the lung inflammation has been very serious, pulmonary congestion, need to borrow equipment to assist breathing, and the patient himself has high blood pressure and heart disease and other carry-on disease history, in general, the patient’s infection is a more serious column.

Thai medical expert group, through comprehensive consideration and clinical trials, through HIV antiretroviral drugs and anti-flu drugs combined drug protocol program: daily morning-night HIV antiretroviral drugs, while taking anti-flu virus oseltamivir early-to-late daily anti-flu virus Oseltamivir, patients should be completely descarbexed!

The third part…

更可喜的是,美国方已经承诺不会为该药物引进中国不会做任何阻碍!美国总统特朗普和美国公共卫生行政部门已批准:

如果我国临床试验效果OK,中国就可以免费试用该药物,一直至4月27日!

就在临床试验效果不错的消息传来,高层就立即做出相应,可谓夜以继日在奋战!就在今天下午,科技部已经宣布,一批瑞德西韦药物于今天下午抵达国内。

Translation…

What’s more, the U.S. has promised not to introduce China for the drug without any hindrance! U.S. President Donald Trump and the U.S. Public Health Administration have approved:

If the results of clinical trials in China are OK, China can try the drug for free until April 27!

Just in the clinical trial effect of good news came, the high-level immediately made the corresponding, can be said to be fighting day after night! Just this afternoon, the Ministry of Science and Technology has announced that a batch of Redsiewe drugs arrived in the country this afternoon.

And just like that…

  • A patented American drug cures a patented American virus.

American media reports two types of stories… for two types of audiences;

  • It’s natural, and is pretty harmless. The flu is much worse.
  • It’s a biological weapon released by the communist dictatorship on the Chinese people. Either intentionally or accidentally.

Update 5

This is a serious virus that contaminates so very easily and quickly.

Infected in 15 seconds while he bought vegetables at the market.
GIC Team GICexpat 6FEB20

A 56-year-old man in Ningbo was recently confirmed as a newly found case to have contracted the novel coronavirus after visiting a food market in the city’s Jiang Bei district on January 23. The confirmation was released to the public on February 4 by the district’s official social media account.

What’s especially surprising about this case is how fast the man contracted the virus.

Video surveillance revealed that it only took 15 seconds for him to be fully exposed, as neither he nor the 61-year-old woman standing next to him while picking out vegetables at the same stall were wearing protective masks.

The woman is believed to have had contracted the virus a few days prior while attending a blessing ceremony.

The man and woman, now both affected by the 2019-nCoV, did not know each other before crossing paths at the Shuang Dongfang market.

Unfortunately, 19 people who subsequently came into close contact with the newly-infected 56-year-old patient have already shown positive signs of infection. All of them have been put under isolated medical observation for further examination.

Update 6

Police are forcefully taking sick people into quarantine. Many refuse to go along, and have to be carried out of their homes.

Forcefully removed from their home.

Update 7

The Western American mainstream narrative is that this is nothing, just a “natural” virus. It’s not so lethal or worrisome. It’s not as bad as the flu. Though, I have yet to see any person with the flu act like this…

Not as bad as the flu they say.

Update 8

A good laugh. Written in the middle of a lethal American bio-weapons attack on China, The Washington Standard defends United States global actions, eight simultaneous wars and bio / economic warfare. Is America Now “The Evil Empire”? .

Their conclusion; no, not at all.

Communism is.

Well, because of history. Mao, Stalin, Hitler, and many others, such as Pol Pot killed millions of their countrymen.

Except China is Communist in Name only, just like America is a Republic in name only.

  • China is a Republic. It follows the same model as pre-political party United States. Pure communist construction was discarded in the early 1970’s.
  • America is an Oligarchy. It was started as a Republic. Changed into a Democracy with the passage of the 12th and 17th amendments, and the progressive “improvements” of President Wilson et.al. solidified the oligarchy we know of today.

Update 9

February 10th, a group of companies will try to resume work, if you happen to be employees of these enterprises, please be sure to take a hard look at the following 10 recommendations:

1, carry your ID card with you

2, at least 3 masks.

3, vial alcohol 1 bottle (but please note keeping, do not smoke)

4, 1 phone sealbag

5, pen 1

6, home-cooked meals

7. Don’t touch colleagues

8, wash your hands frequently

9, cycling to and from work

10. Looking for a new job (don’t ask why, this time to let you go to work company, must not be a good company ( tears) #职场达人说#职场进化论 #

Translation from the Chinese government alert;

2月10日即将有一批公司尝试复工,如果你正好是这些企业的员工,请一定要认真看以下10条建议: 1,随身携带身份证 2,至少3个口罩 3,小瓶酒精1瓶(但请注意保管,别抽烟) 4,手机密封袋1个 5,笔1只 6,自家煮的饭菜 7,不要触碰同事 8、勤洗手 9、骑车上下班 10、寻找新工作(不要问为什么,这个时间还要让你们去上班的公司,一定不是什么好公司[泪奔])#职场达人说# #职场进化论#

Update 10

First, the Chinese government has treated the epidemic as an act of war, deploying all the means at its disposal, including the military, in order to contain its spread, building several large new hospitals, putting entire huge cities under quarantine and extending the national holidays. The response as been far beyond what this virus seems to warrant, with its low mortality rate.

Second, the Western media response has been an exemplary effort to produce a panic and to smear China, making what is happening there into a horror story. Not only did the mass media outlets do their best to stoke mass hysteria about all things Chinese, but various bloggers and independent “experts” pitched in to produce a panic.

Third, the White House has recently requested that experts look into the possibility that 2019-nCoV has been genetically engineered… I suspect that the next move will be to declare that this virus is indeed an engineered biological weapon developed by Russia, of course.

Dmitry Orlov has his suspicions about the 2019-nCoV flu, at Club Orlov

Update 11 – 13FEB20

From the Jerusalem Post

Arab media accuse US, Israel of coronavirus conspiracy against China

One report claimed that it was no coincidence that the coronavirus was largely absent from the US and Israel.

Numerous reports in the Arab press have accused the US and Israel of being behind the creation and spread of the deadly coronavirus as part of an economic and psychological war against China, the Middle East Media Research Institute (MEMRI) reported.

One report in the Saudi daily newspaper Al-Watan claimed that it was no coincidence that the coronavirus was absent from the US and Israel, though this is despite America having 12 confirmed cases at the time of writing.

“A ‘wonder’ virus was discovered yesterday in China; tomorrow it will be discovered in Egypt, but it will not be discovered either today, tomorrow or the day after tomorrow in the US or Israel, nor in poor countries such as Burundi or the Comoro Islands,” the report said.

It also went on to accuse the US and Israel of being behind other outbreaks over the past several years in China and in the Arab world.”As soon as Egypt announced, a few years ago, that it would rely on poultry , and that it would even export [poultry] abroad – that is, that it no longer needed poultry from the US, France, and so on – [suddenly] there appeared, from underneath the ground, the avian flu virus… with the aim of nipping [Egypt’s economic] awakening in the bud,” the report said.”

Even before this, the same thing was done in China… when in 2003 [the country] announced that it had the [world’s] largest dollar reserves they [the Americans] introduced coronavirus’ cousin, SARS, into [the country].”

At the beginning of February, Syrian daily newspaper Al-Thawra also claimed the coronavirus and other outbreaks were part of a US-China war.

“From Ebola, Zika, SARS, avian flu and swine flu, through anthrax and mad cow disease to the corona[virus] – [all these] deadly viruses were manufactured by the US and threaten to annihilate the peoples of the world,” the report alleged.

“[The US] has turned biological warfare into a new type of war, by means of which it intends to change the rules of play and shift the conflict with the peoples [of the world] away from the conventional path.”A report on the Egyptian news site Vetogate.com built on this theory even more, specifying why Wuhan was supposedly chosen as the epicenter of the current outbreak.”

American factories are the first to manufacture every kind of virus and bacteria, from the virulent smallpox virus and the bubonic plague virus to all the viruses we saw in the recent years, such as mad cow disease and swine flu,” the site claimed.

“Wuhan, the city that has now been struck by the corona[virus], is an industrial town, but it is nevertheless the eighth-richest city in China after Shanghai.”Guangzhou, Beijing, Tianjin and Hong Kong, are the country’s major cities.

[Wuhan’s] place at the bottom of the list [of China’s major cities] is what makes it a suitable [place] for an American crime… for it is not a focus of attention, and the level of healthcare there is surely lower than in the larger and more important cities.”

The news site adds that there is a theorized economic motivation for the outbreak, as the supposed masterminds behind it will reap the billions of dollars spent by China on emergency treatments and medicines, “which, by the way, will be manufactured by an Israeli company.”

Over 37,000 people around the world have been infected with the coronavirus as the outbreak continues to spread. The current death toll is over 800 people.

Links

Some general links…

It is very easy to find links and discussions of “the illegal collection of Chinese DNA by America” on the internet as the following links attest.

Here’s some HK links in English. There shouldn’t be any question that drones were used to spread swine flu during the heat of the trump trade wars. That is all well documented.

Whether they worked in behalf of the USA government is speculation. Most articles claim that they are working independently as part of a “criminal element”.

As far as the design of the drones, most commercially available drones are manufactured in Guangzhou. So, getting some drones and having them modified professionally, locally within China isn’t too much of a stretch. I do that all the time myself for other “projects”.

What is the question that people should be asking is HOW the “criminal elements” got a hold of “swine flu”, and learned how to handle it, use it, and disseminate it. Because, boys and girls, the virus dies once it is removed from a live host…

Chinese criminals use drones to infect swine flu –
Chinese criminal gangs spreading African swine fever to
Chinese Gangs Use Drones to Spread African Swine Fever …
Chinese Gangsters Reportedly Using Drones to Spread …
Chinese gangsters use drones to spread African swine fever …
China flight systems jammed by pig farm’s African swine …
Commercial pig farm in China jams drone signal to combat …
The Chinese gangsters using drones to spread African swine …
Chinese Gangsters Reportedly Using Drones to Spread …
A fierce fight in a pig farm that repels drones with a …
Chinese pig farm jams drone of swine fever crooks

(Republished from MetallicMan by permission of author or representative)
 
Hide 518 CommentsLeave a Comment
Commenters to Ignore...to FollowEndorsed Only
Trim Comments?
    []
  1. “All I did was sleuth though public, but forgotten articles, and stung things together into a thesis.”

    Not exactly. What you did was to plagiarise articles on this subject, mostly from Larry Romanoff’s articles published on Global Research. Probably 40% of your article is copied verbatim without attribution.

  2. Biff says:

    Whew””””””” That was a long read… Not totally convinced, but the timing of everything has me believing that there is a good chance corona virus is a man made weapon.

    • Replies: @Herald
    , @Justsaying
  3. Ber says:

    A bit long but very informative. Thanks

    • Replies: @williamwiliams
  4. utu says:
    @Ayatollah Smith

    “40% of your article is copied verbatim without attribution.” – So it should be easy for you to give several examples.

  5. anon[209] • Disclaimer says:

    “It highly contagious. It’s of a factor many, many time contageous than any other known virus.”

    I stopped reading here. Aside from misspelling contagious, the statement is objectively false.

  6. zimriel says:

    When a headline ends with a question-mark the answer is always ‘no’.

    What I’ll take from this, given that this is an antiAmerica propaganda site in general, is that it is now obvious that this virus is bad for China, so we’re now in the process of casting blame.

    • Replies: @annamaria
  7. God fucking damn.

    All I want and need was for this shit show to go on for 9 more years.

    Wtf is up with USA letting lunatics into positions of power?

    As I stated previously, if only the Chinese are infected and dying, this 99.999% screams bio weapon.

    Chinese needs to step up their game. Wtf is this shit letting their population centers getting attack like this without blow back? Those 250 nukes are no longer enough. Build 1000 more. Having the ability to make every square inch of any country with American bases radio active and green might stop the madness.

    If this article is even half true, fuck all of us. We are all going to die sooner or later because the fuckers at DC are fucking insane.

    Fucking hell. Fuck.☢️☣️☢️

  8. criolle says:

    “A full “regular” hospital is being constructed (in ten days) to handle the problem.”

    I have participated in SEVERAL Hospital construction projects.
    You might clear the land and pour the foundation in ten days.
    Might.
    Getting the walls built and pouring the second floor within two weeks is VERY “iffy”.
    NO WAY IN HELL can you construct the roof inside ten days.
    Inside walls alone will take another two weeks.
    Ventilation lines will take AT LEAST another week, working nights and weekends. (Ventilation has to be installed before electrical and ceiling work can take place.)
    Plumbing (water and sewer) can go in alongside electrical. LOOK at how many circuits go into a hospital room sometime! Even bare-bones requires a lot of conduit and wire runs. Figure four more weeks. This assumes maximum crews, working nights and weekends.
    Cabinets, desks, doors … another week AND communications has to be installed AFTER that.

    TLDR: These are BARRACKS for sick, not Hospitals.

  9. gotmituns says:

    so if only orientals get this virus, does that mean there are differences in the races?

    • Replies: @Curmudgeon
    , @Beau Nydle
  10. slorter says:

    Certainly not beyond the realm of possibility! Food for thought!

  11. Smith says:

    So long but any actual proof?

    • Agree: eah
    • Thanks: Hail
  12. Delta G says:

    I do not even have to read the entire article to say it is somewhere between Dog Barf and Bull Shit.

    Just horseshit strung together to make people who do not know anything about Virology or Immunology or Biology or Medicine shiver in their boots.

    I believe the authors are CIA folks trying to act like Bio-warfare is something real today.

    It is not.

    Also, lets look at reality for a second even if the US of morons, who can’t find their assholes with a mirror, could actually make such an amazing weapon.

    1. No matter what anyone says you cannot control such a weapon. It will come back at you and kill you too. It is a biological entity and you have no control once it is released into the environment.

    2. Look at the economic collapse that may be coming soon because of the slowdown in China’s Manufacturing of everything the world uses and needs especially the US of morons.

    3. Nothing that has happened yet with the Corona Virus is unusual except to some $hit eating moron who wrote this pile of garbage.

    Ron Unz has made a disgrace of himself by putting this crap on his website. I do have great respect for the site overall, but now none for the Editor.

  13. Chinaman says:

    An appropriate response by the Chinese is needed. Revenge best served cold…

    • Troll: Hail
  14. niceland says:

    I quickly browsed the links and my quick impression is; It looks likes most, if not all, of the articles cited for the swine flue drone story could rely on the same source and basically be reporting different versions of single incident that happened in Heilongjiang province.

    Here is one version:

    BEIJING (Reuters) – One of China’s biggest animal feed producers said it had used a radio transmitter to combat crooks using drones to drop pork products contaminated with African swine fever on its pig farms, as part of a racket to profit from the health scare.

    In July, China’s agriculture ministry said criminal gangs were faking outbreaks of swine fever on farms and forcing farmers to sell their healthy pigs at sharply lower prices.

    And on Thursday, a state-backed news website, The Paper, reported that a pig farming unit of Beijing Dabeinong Technology Group Co Ltd had run foul of the regional aviation authority, as its transmitter had disrupted the GPS signal in the area.

    Answering questions from investors on an interactive platform run by the Shenzhen Stock Exchange, Dabeinong confirmed on Friday that its pig farming unit in Heilongjiang province had unwittingly violated civil aviation rules.

    “Our unit in Heilongjiang province… to prevent external people from using drones to drop pork with African swine fever virus, violated regulations by using a drone control equipment set,” the company said.

    https://news.yahoo.com/commercial-pig-farm-china-jams-063621537.html

    At first glance it seems to me this single incident is the basis for the whole thing. And some media outlets then blew it out of proportion. It’s possible the farmer wasn’t even telling the truth as to why he was jamming GPS signals to get rid of drones flying over the farm. Even around my neck of the woods farmers in general are not overly found of drones for various reasons. But if one is caught jamming GPS signals it’s probably better to spice the excuse up a bit and what better than someone dropping virus when there is a flue outbreak?

  15. Willem says:

    Long question with a short answer:

    No

  16. Almajiri says:

    Another smoking gun not mentioned is the anglosaxon mission, where they said “china will catch a cold” (read both the interview and the timeline a simple web search will lead you to both!). There is no way this is not an act of warfare against China, next will be Iran, Russia, and then the rest of the world. They are following their Georgia guide stone ten commandments.

    • Replies: @Anonymous
  17. Alfred says:

    Anyone who is not convinced that the USA is carrying out biological warfare against China and probably other countries, should read this:

    Biological Weapons: A Useful and Timely Factual Overview
    Part I (GlobalResearch and Zerohedge)

    Here is another article from the main German government-controlled news website (Deutsche Welle). Of course, they called it “Russian disinformation” – but people did die according to other sources.

    Russia claims US tested biological weapons in Georgia, killing 73

    • Replies: @thetruth
  18. Almajiri says:

    This attack has already been announced before (web search “the anglosaxon mission” and “timeline of the anglosaxon mission”). It also serves as a warning to all those nations that are not willing to become vassals of the anglo-Zionist-Wahhabis (Russia, Iran) and all Sahelian countries, and those countries that are “non-integrating” as per “The Pentagon’s New Map.”
    There is no way this is not a declaration of war against China, Russia, Iran and the rest of humanity!

    • Replies: @Ber
  19. Alfred says:

    There is a lot of talk about how long it will take to create a vaccine for this virus – COVID-19. Consensus seems to be 12+ months. Of course, that would ensure that almost all people worldwide with Chinese genes would get infected. Some suggest that surviving infection does not prevent reinfection a year later. COVID-19 could become endemic.

    We have all seen the factor R0 (Reproduction Number) mentioned in articles. If R0 is above 1, the virus will continue propagating. If R0 is much less than 1, the virus will quickly die out. For COVID-19, R0 is much higher than 1 – that is why it spreads so fast.

    Clearly, it is imperative to reduce R0 and that is the purpose of quarantines and isolation of cities and villages. The latency of this virus makes quarantines much less effective since infectious people show no symptoms.

    If a rapid, cheap, accurate test were available, it would be possible to have a quarantine system that actually works. The only way to do that is if this test detected individual virus particles – not the antibodies. This is not science fiction. It has been done for other virus.

    I believe that the effort to locate a vaccine is a waste of time. New versions of this virus can be readily engineered and distributed. Also, it would mean vaccinating everyone yearly or something like that. It is totally impractical. But the wet dream of Big Pharma.

    Research and development should be directed at detecting the virus in apparently healthy people and organizing a way of separating people who are carrying the virus until they have no more virus in their blood.

    The above is very obvious to me. I have mentioned it before in a previous post. No one has taken the hint. Are you all fast asleep? Is it intellectually very difficult to grasp?

  20. Sean says:

    The Spanish flu was very unusual, originated on an American Army base and was a big part of why the 1918 Stormtrooper offensive didn’t win WW1 for Germany. ‘Who benefits?’ arguments require the means to be credibly available to attain the end through.

    It’s a biological weapon, but it’s China’s fault. They had a biological weapons lab in the middle of one of the largest centrally located Chinese cities and it somehow escaped.

    America creating and then letting the Chinese use espionage to acquire the virus, then using US secret agents in China to compromise their isolation of the virus causing it to get out of China’s control and decimate China would be a clever stratagem, but still a little obvious.

    It would be better to secretly create a specialised Chinese killing virus and let the Russians steal it, then use US assets to engineer a lab accident in Russia. The virus would have to kill some (a million or so) whites in Russia and America, otherwise it would be too obvious that it had been aimed at destroying China. I wish I could believe the West had the knowhow and the will.

  21. Thomasina says:

    I see they are calling this new virus SARS-COV-2. The illness is being called COVID-19. Is this a mutation from SARS-COV-1?

    I recently read an article stating that every year the CDC travels to Asia to determine what strains of flu will be arriving in the West, and I’ve read this before in other articles. If this is true, then why does the flu always seem to emanate from Asia? Why does it always start there?

    Bats are one of the main causes of zoonotic transmission to other animals. China cages these animals in tight containers, piled one on top of the other, in hot, humid conditions, and then they are sold in open markets. And if the bats are housed anywhere near live chickens, it’s understandable how these diseases could be transferred to the chickens, and then on to humans.

    I’m not a scientist, but to me it doesn’t seem odd that only Chinese people would be getting sick. It could be that it just hasn’t had enough time to infect the West yet, or it could be the Chinese are a little different genetically. Different races sometimes do get different diseases. And SARS-1 started in China too, didn’t it?

    One of the reasons they brought Africans over to work on the plantations is because they initially tried using Europeans, but they died from malaria. Native Indians didn’t fare too well either. It was only then that they brought over the Africans because they were immune to malaria.

    If it was a bioweapon, that truly would be evil. I hope the worst will be over for China soon.

  22. Alfred says:

    It is amusing to see how some people manage to see some good in this disaster – or at least pretend to do so. Here is an article from my previous local newspaper in Cairns, Australia:

    Almost 30,000 extra cruise ship visitors will pull into the Far North this year as companies reroute their itineraries away from the Asia-Pacific in the wake of the coronavirus outbreak.

    New cruise ships now redirected to Far North (Cairns Post Front Page)

    The reality is that it is devastating to the local economy of Cairns and no amount of gloss is going to change that. Far more tourists arrive by plane. Those who arrive by plane book hotels, rent cars or tours and stay for days or weeks. Those who arrive by cruise ship visit the place for a few hours at best. Flights are being cancelled from lots of destinations.

    Coronavirus flight cancellations leave Chinese tourists stranded in Cairns

    IMHO, these Chinese tourists are the lucky ones. I can think of lots of worse places to be stranded in. 🙂

    Because of the massive effort to pretend that we are all racially identical and that this is not a bioweapon, many European visitors will cancel. It is peak season for the Great Barrier Reef at present.

    • Replies: @Buck Ransom
  23. This article would be more effective for the price of a relentless copy editor.

    • Agree: Erebus
    • Replies: @CanSpeccy
  24. Parfois1 says:

    A juicy melange combined with a fishy bouillabaisse making a concoction of speculative but believable soup yet hard to swallow because of the chunky bones. Very hard to digest too for those with sensitive stomachs.

    On the other hand, that was my major conjecture: the neo-corona virus epidemic is likely to have been concocted by the neocons. Having realized the inevitable end of US economic and military supremacy, they resort to a hybrid war of deniable actions to delay and disrupt the Chinese juggernaught.

    From a political elite proven by recent history to be capable of the most horrendous crimes against humanity (e.g. the incineration of Japanese and German cities as acts of unimaginable cruelty) no horror is beneath them. In fact, their MSM mouthpieces are salivating with relish for the Chinese current predicament and hardship. In keeping with the culinary taste, this is only small fish to them.

    Don’t be surprised if the Chinese of a fine morning one day exact a payback. Their giant steps in all scientific fields don’t augur well for Uncle Sham’s subjects who share similar DNA with their political masters.

    • Agree: Alfred, Robjil
  25. @Astuteobservor II

    If only the U.S. had a few of its own nukes to return the favor.

    Boy, you are an easy mark for the obvious propagandist.

    • Replies: @Astuteobservor II
  26. Whitewolf says:

    China is a Republic. It follows the same model as pre-political party United States. Pure communist construction was discarded in the early 1970’s.

    So China is just like the U.S. used to be before it got corrupted? Lol. China can call itself a republic or whatever but it’s still a totalitarian state. It’s economic growth has been remarkable but much of that came courtesy of the same people you claim want to attack Chinese people with bioweapons.

    If there’s any people the rulers of the U.S. want to get rid of it’s White people not Chinese. Whites are maligned in the media much more so than the Chinese.

    • Agree: TKK
    • Disagree: Biff
    • Replies: @Daemon
  27. The term ‘swine flu’ should be used for swine influenza only. African swine fever is a completely different virus and disease – and the one that is currently devastating Chinese pig production.

    • Replies: @Meena
  28. criolle (8.) says:

    “Getting the walls built and pouring the second floor within two weeks is VERY “iffy”. NO WAY IN HELL can you construct the roof inside ten days. Inside walls alone will take another two weeks. Ventilation lines will take AT LEAST another week . . . . ”

    Your assumptions are incorrect, thus your conclusions also. These are modular concrete units similar to those used in field offices or crew quarters. They are designed for rapid assembly, in a manner similar to setting shipping containers side by side. They are also designed to accommodate A/C, heating, ventilation, negative pressure, abundant electricity, and more.

    Once assembled, these units function as a whole, and are a regular hospital with all the equipment and facilities one would normally see in any hospital.

    The first was built in ten days by 16,000 men, the shifts working 24 hours a day. The second hospital was larger, and completed in only 6 days. To clear and level the site and lay the substructure, there were 240 pieces of construction equipment working at the same time – also 24 hours per day.

    • Replies: @Anonymous
  29. Alfred (20.) says:

    “There is a lot of talk about how long it will take to create a vaccine for this virus – COVID-19.”

    A vaccine may not be necessary. Chinese virologists discovered that recovered victims contain substantial antibodies in their blood after recovery, and have used their blood plasma to extract the antibodies and treat the critically ill. Initial reports are that the patients already show a marked improvement after only 12 to 24 hours.

    Also, they are combining traditional Chinese medicine with other treatments, with some good success. There may be no market here for the WHO to promote Western vaccines.

    • Thanks: Alfred
    • Replies: @Culpepper
  30. “You do not need to believe me.”

    Oh, good, because I don’t. Not knee-jerk ruling it out, but unconvinced all the same. The style is in-your face propaganda, very one-sided. Could also be a Chinese weapon gone wrong, no?

  31. Certainly food for thought. Will take some time to think in.

  32. Quite apart from the iffiness of its content, this is a terribly-written article.

    A good example for a journalism or writing course of how not to things.

    Patchy. Repetitive. Jumpy. Seems to have been assembled from pieces, I could not continue reading it.

  33. Alfred (20.) says:

    “If a rapid, cheap, accurate test were available, it would be possible to have a quarantine system that actually works. The only way to do that is if this test detected individual virus particles – not the antibodies.”

    That is precisely what the Chinese tests did. Within the first week, they developed an accurate test for the virus body itself. The reason they later went to CT scans (in addition) is that the original tests take more time, the results are not immediate, and supplies were always under pressure.

    • Replies: @Mike P
    , @Alfred
  34. anonymous[340] • Disclaimer says:

    Those reports are also nonsense.

    Bio-engineers have confirmed that trans-species “jumping” and mutation of this virus is pretty much impossible.

    You should first consult with the Wuhan Institute of Virology on this matter, as they have been VERY active in the study of these coronaviruses over the last 8 years, especially those derived from bats in China. They have found over 500 coronaviruses, including some that already have the ability to use ACE2 receptors and infect humans. Here are some of their findings, under the “more” tag.

    [MORE]

    2013

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5389864/

    Here, we report whole genome sequences of two novel bat CoVs from Chinese horseshoe bats (Family: Rhinolophidae) in Yunnan, China; RsSHC014 and Rs3367. These viruses are far more closely related to SARS-CoV than any previously identified bat CoVs, particularly in the receptor binding domain (RDB) of the S protein. Most importantly, we report the first recorded isolation of a live SL-CoV (bat SL-CoV-WIV1) from bat fecal samples in Vero E6 cells, which has typical coronavirus morphology, 99.9% sequence identity to Rs3367 and uses the ACE2s from human, civet and Chinese horseshoe bat for cell entry. Preliminary in vitro testing indicates that WIV1 also has a broad species tropism. Our results provide the strongest evidence to date that Chinese horseshoe bats are natural reservoirs of SARS-CoV, and that intermediate hosts may not be necessary for direct human infection by some bat SL-CoVs.

    However, the ability of SL-CoV-WIV1 to use human ACE2 argues against the necessity of this step for SL-CoV-WIV1 and suggests that direct bat-to-human infection is a plausible scenario for some bat SL-CoVs. This has implications for public health control measures in the face of potential spillover of a diverse and growing pool of SARS-like CoVs with a wide geographic distribution.

    Our findings suggest that the diversity of bat CoVs is substantially higher than that previously reported. In this study we were able to demonstrate the circulation of at least 7 different strains of SL-CoVs within a single colony of Rhinolopus sinicus during a 12-month period. The high genetic diversity of SL-CoVs within this colony was mirrored by high phenotypic diversity in the differential use of ACE2 by different strains. It would therefore not be surprising if further surveillance reveals a broad diversity of bat SL-CoVs that are able to use ACE2, some of which may have even closer homology to SARS-CoV than SL-CoV-WIV1

    2016

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4810638/

    ABSTRACT

    We report the isolation and characterization of a novel bat coronavirus which is much closer to the severe acute respiratory syndrome coronavirus (SARS-CoV) in genomic sequence than others previously reported, particularly in its S gene. Cell entry and susceptibility studies indicated that this virus can use ACE2 as a receptor and infect animal and human cell lines.
    Our results provide further evidence of the bat origin of the SARS-CoV and highlight the likelihood of future bat coronavirus emergence in humans.

    We recently isolated a bat SL-CoV strain (WIV1) and constructed an infectious clone of another strain (SHC014); significantly, these strains are closely related to SARS-CoV and capable of using the same cellular receptor (angiotensin-converting enzyme 2 [ACE2]) as SARS-CoV.

    2020

    https://www.ncbi.nlm.nih.gov/pubmed/32015507

    We then found a short RdRp region from a bat coronavirus termed BatCoV RaTG13 which we previously detected in Rhinolophus affinis from Yunnan Province showed high sequence identity to nCoV-2019. We did full-length sequencing to this RNA sample. Simplot analysis showed that nCoV-2019 was highly similar throughout the genome to RaTG13 (Fig. 1c), with 96.2% overall genome sequence identity.

    https://www.sciencemag.org/news/2020/01/mining-coronavirus-genomes-clues-outbreak-s-origins

    Bedford’s analyses of RaTG13 and 2019-nCoV suggest that the two viruses shared a common ancestor 25 to 65 years ago, an estimate he arrived at by combining the difference in nucleotides between the viruses with the presumed rates of mutation in other coronaviruses. So it likely took decades for RaTG13-like viruses to mutate into 2019-nCoV.

    It’s interesting that RaTG13 is so closely related to 2019-nCoV. Could their source location and host populations be similar as well? They mentioned having found 7 different strains in a single bat colony at one point.

    Peter Daszak and Zheng Li Shi found RaTG13 in 2013.

    Daszak and Shi’s group have for 8 years been trapping bats in caves around China to sample their feces and blood for viruses. He says they have sampled more than 10,000 bats and 2000 other species. They have found some 500 novel coronaviruses, about 50 of which fall relatively close to the SARS virus on the family tree, including RaTG13—it was fished out of a bat fecal sample they collected in 2013 from a cave in Moglang in Yunnan province. “We cannot assume that just because this virus from Yunnan has high sequence identity with the new one that that’s the origin,” Daszak says, noting that only a tiny fraction of coronaviruses that infect bats have been discovered. “I expect that once we’ve sampled and sampled and sampled across southern China and central China that we’re going to find many other viruses and some of them will be closer [to 2019-nCoV].”

    I have not yet been able to find a publication or a reference to RaTG13 prior to the 2019-nCoV.

  35. clickkid says:

    Absolutely superb article!

    Thank you ‘Metallicman’, very well laid out.

    Thanks to Ron Unz too for publishing.

  36. This is very depressing. Since White Europeans seem hell bent on destroying themselves, I figured the East Asians at least will be around to carry the mantle of civilization. But if the East Asians are genocided who does that leave? The only possible future is a Dark Age to end all Dark Ages.

    • Replies: @Just passing through
  37. clickkid says:

    Tweeted on 11th June 2019 by a Turkish nationalist with connections to his country’s military:

    Translation:

    “The U.S. sent an aircraft of biological weapons to China. Epidemics may begin in China soon.

    They should not forget that if there is a Turk on earth, there is hope.”

  38. Thank you ‘Metallicman’, very well laid out.

    No this I can’t let stand. This article was a mess. It was not well laid out.

    You clearly agree with it politically, but this article was clearly not well laid out.

    • Replies: @Herald
  39. Anonymous[278] • Disclaimer says:

    It wasn’t widely reported, but it seems the final conclusion of the Chinese biochemists was the same, that the SARS virus was man-made.

    Yes, it was man-made. By the Chinese. Because it was engineered in the Beijing Institute of Virology.

    https://www.the-scientist.com/news-analysis/sars-escaped-beijing-lab-twice-50137

    The Russians would know about accidental releases of bioweapons. Like their own Sverdlovsk anthrax leak.

    https://www.sciencealert.com/biologists-have-decoded-a-secret-russian-bioweapon-decades-after-it-escaped-the-lab

    It is confirmed again that SARS escaped from Chinese BSL-3 labs

    https://www.nature.com/news/inside-the-chinese-lab-poised-to-study-world-s-most-dangerous-pathogens-1.21487

    That same article makes the point about Dual-Use research. There is no distinction between ‘diagnostic’ and ‘directed’ research in dual-use research.

    In order for the author’s thesis to have any validity, he has to argue that China which has conducted CRISPR research on human embryos, wouldn’t and couldn’t possibly engage in dual function research.

    Such a claim doesn’t bear any scrutiny – it can be dismissed our of hand.

    It’s ridiculous to suggest that the purpose of research and related materials has any bearing on the consequences of a leakage. If anything, the author’s emphasis on the vaccination angle supports the thesis that vaccination material escaped from the Wuhan BSL-4 facility.

    [MORE]

    https://www.ncbi.nlm.nih.gov/pubmed/23241622

    The building picture shown by this author is NOT the building showed at the address of the Wuhan facility. It was and is an apartment building. Obviously Google Dragonfly paid off because now Google won’t allow a street view of the facility. Why is that? Because it’s clear the Chinese put a BSL-4 lab in what likes a downscale New York Hotel. Go on – try and view the facility. See if archived versions match that image. They don’t.

    It was accredited by an internal Chinese accreditation agency. Do the Chinese ever cut corners?

    The Chinese are the most merit-driven people on the world. This is true whether they are in school or working in a company. This narrative is something that does not fit with any Chinese that I know about

    https://www.scmp.com/comment/insight-opinion/article/1974986/why-do-chinese-students-think-its-ok-cheat

    It’s not just the gaokao – it’s the SAT, the GRE, and a whole host of other exams. An estimated 90 per cent of all recommendation letters for Chinese applicants to United States universities are fake. Some 70 per cent of application essays are not written by students, and 50 per cent of grades transcripts are falsified.

    ‘Merit-driven’

    https://www.scmp.com/news/china/article/1259125/china-grapples-attacks-teachers-after-cheating-halted-college-exam

    “Everyone is trying to break laws in China,” one microblogger wrote. “That’s why those [students] who were caught [cheating] call it unfair.”

    “That’s what happens when there’s no rule of law in this country,” another wrote.

    ‘Merit-driven’.

    https://www.reuters.com/investigates/special-report/college-sat-one/

    “Part One: Internal documents show that the U.S. college entrance exam has been compromised in Asia far more often than acknowledged. And the newly redesigned SAT retains a key vulnerability that the test-prep industry has exploited for years.”

    “In addition to the security-related incidents the College Board has announced, the news agency identified eight occasions since late 2013 in which test material was circulating online before the SAT was administered overseas. (See table for details.)”

    ‘Merit-driven’.

    ‘Merit-driven’.

    ‘Merit-driven’.

    https://www.nytimes.com/1999/04/05/world/soviet-defector-says-china-had-accident-at-a-germ-plant.html

    China has had many accidents at Germ plants. The Soviets saw China create two serious pandemics – back in a story from 1999.

    ‘Merit-driven’.

    China couldn’t possibly have accidentally released a virus because China is very merit-driven.

    No, China is not very ‘merit-driven’.

    https://fortune.com/2019/11/30/dna-tests-us-china-results/

    Why has China been collecting DNA samples of hundreds of thousands of western Europeans and non-Chinese?

    “Regulations enacted in July gave the government access to data held by genetics companies for national security, public health and social interest reasons. The company “respects the law,” said Zhou. “If the law permits the government‘s access to the data, we will give it,” he said.”

    https://web.archive.org/web/20190212213627/https://www.cnbc.com/2019/02/12/privacy-concerns-rise-as-26-million-share-dna-with-ancestry-firms.html

    Jewish owned companies like ancestry.com and 23 and me had data on 26 million people, almost all American and European.

    Why isn’t the author talking about China buying access to that data?

    Anna Wojcici was married to Sergei Brin, who left Google under mysterious circumstances, at the time Google was developing ‘Google Dragonfly’ a social credit mechanism and grand firewall for the CCP. In close partnership. It caused a Google revolt of personnel, and supposedly was ended.

    https://www.politico.com/story/2018/12/19/google-shareholder-revolts-project-dragonfly-1037966

    Does anyone really think Google under Brin wouldn’t be doing deals with China for that western DNA data? Apparently, 23 and me has enough DNA samples to extrapolate DNA for entire western populations. Glaxo Smith Kline has the material – who believes that China doesn’t, given what Google and Facebook were doing with American data with Chinese partners.

    Don’t do the standard communist technique per Saul Alinsky and handbooks written for the Chinese communist party by Alinksy’s fellows by accusing people of what you are doing. Israel Epstein, Sidney Rittenburg, Robert Lawrence Kuhn and Sidney Shapiro all advised and even helped create the CCP.

    Don’t accuse other people of what you are doing.

    As with SARS, this new virus appears to be tightly-focused and race-specific to Chinese.

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5389864/

    Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor

    Of 20 authors, only 4 aren’t a Chinese name. One is ‘Epstein’ interestingly enough.

    Here was the key finding about a naturally derived Corona-Virus from Chinese bats, all the way back in 2013:

    “Our results provide the strongest evidence to date that Chinese horseshoe bats are natural reservoirs of SARS-CoV, and that intermediate hosts may not be necessary for direct human infection by some bat SL-CoVs”

    A key factor in this author’s accusation is that a Corona Virus a) can’t be naturally based b) can’t be naturally based in a way that might have a higher propensity for transmission to Asians.

    Both suppositions are false.

    From the study:

    “Most importantly, we report the first recorded isolation of a live SL-CoV (bat SL-CoV-WIV1) from bat fecal samples in Vero E6 cells, which has typical coronavirus morphology, 99.9% sequence identity to Rs3367 and uses the ACE2s from human, civet and Chinese horseshoe bat for cell entry

    https://www.biorxiv.org/content/10.1101/2020.01.26.919985v1.full

    This was the study that found a single Asian specimen had a higher number of ACE-2 receptors in the lungs.

    So.

    The Chinese identified a bat-based Corona-Virus that used ACE-2 pathways for cell entry in 2013. Now a study finds Asians might have more ACE-2 receptors, based on a single specimen.

    Why is this an American bio-weapon justifying the instigation of World War 3 by China?

    China identified a Virus using the pathway Asians have more of in 2013.

    Does anyone believe that finding wouldn’t have been developed on in the 7 years since? Maybe to try and create a vaccination against SARs, which escaped from a Beijing Lab?

    Because again, a country that has a record of accidentally causing pandemics according to Soviet defectors might want to try and create vaccinations against those pandemics.

    ‘Gulf War Syndrome’

    How many Chinese have Gulf-War Syndrome.

    “There is no substantial reason that officials at any level of the US State Department should concern themselves with a virus outbreak in a foreign country.”

    Why wouldn’t the State Department want to know about a Pandemic threat to major United States populations, which have had possibly hundreds of thousands of Chinese percolating at the salient time.

    “NED support and training of Uyghur Muslim extremists.”

    So the Uyghur’s ‘aren’t’ the victims? What are millions of them doing in reeducation camps?

    https://www.businessinsider.com.au/china-uighur-monitor-home-shared-bed-report-2019-11?r=US&IR=T

    China is putting Uyghur Muslims in concentration camps – then sending Chinese men to rape their wives.

    And this author has the gall to talk about a ‘western genocide’ against the Chinese.

    Maybe westerners don’t want to find themselves in Chinese concentration camps whilst Chinese in official parties rape their wives.

    https://www.taiwannews.com.tw/en/news/3442256

    In Taiwan they’re calling it ‘gene-washing’. Look at that beautiful Uyghur women and that rat-faced Chinese man, while her husband is in a concentration camp, she is forced to marry him surrounded by Han who will beat her and possibly kill her if she doesn’t comply.

    It seems like possibly a misstatement to call resistance to annexation and population scale rape to claim people resisting their wives getting raped are ‘extremists’.

    It would be very easy to refute practically made in this very rambling article. But brevity is important and these points are sufficient to rebut the accusation that is being made.

    Having said all of the above, China’s response to the virus has with a few problems, been very, very impressive and almost exemplary. No western country could emulate the product of a totalitarian government with a ubiquitous surveillance apparatus. No western country could build a massive barracks-hospital in 10 days.

    Despite everything the Chinese do, everybody wants to see them beat the Virus and stop the total implosion of the world economy.

    It is far too early to state that this Virus won’t affect white people or western people.

    It’s totally irresponsible to state what the author is stating, and not supported by the facts, beyond circumstantial connections.

    Linking this to the trade war is also ridiculous. China has operated as a mercantalist economy in a free trade environment and has been cheating on it’s currency for decades.

    You make accusations about Chinese pigs – why have Chinese with official US positions been engaged in arms-trafficking in the United States?

    https://www.justice.gov/usao-cdca/pr/former-customs-and-border-protection-officer-pleads-guilty-federal-charges-running

    One wonders if any of those machine-guns ended up with any of the cartels.

    https://www.nytimes.com/2019/10/16/magazine/china-fentanyl-drug-ring.html

    Why are China flooding the United States and Canada with Fentanyl?

    It was just a really long and rambling article.

    But the evidence is much more suggestive that this was a leak from a Chinese facility if this was indeed a bio-weapon. Asian susceptibility means nothing. The Chinese aren’t ‘merit-drive’. Their facility was totally uufit for purpose. China has a massive bioweapons program of it’s own. There is Chinese research showing a natural leap of a Corona-Virus to humans from bats that will hurt Asians more from 2013.

    And if it was a bio-weapon, it’s a bit rich to just blame it on Americans. Americans want to get troops out of Afghanistan and Iraq. Somehow I don’t think they want war with China.

    No one takes any pleasure in seeing other human beings suffer. But people also don’t take pleasure in incitements to make human beings suffer. World War 3 isn’t a good idea.

    And what is the difference between a western European and a Uyghur. I quite like my wife. I don’t think I want to be put in a Chinese camp whilst Chinese men endorsed by the Chinese government rape her to ‘gene-wipe’ her under Han Minzu Zhuyi.

    • Troll: vot tak
    • Replies: @ThreeCranes
  40. Parfois1 says:
    @criolle

    NO WAY IN HELL can you construct the roof inside ten days.

    That may be so in Hell, or where you live, or elsewhere on Earth, except in China. They can do the most amazing feats of engineering prowess, including building a fully functional 1,600-bed hospital in ten days! In your country – or mine for that matter – it would take 10 months at least. They build megacities such as Xiongan in ten years!

    No wonder Uncle Sham is quaking in his oversized boots – a greater power is rising. The worst nightmare is that the new China is a monument to Socialism and he hates the totalitarian commies for building everything faster, better, higher, bigger and stronger.

    He should call it a day, hang his boots and put out to pasture. Or be euthanized.

  41. Rahan says:

    I did not know about the drones spraying swine flu.

    Informative!

    Remembering how the USSR was destroyed over a decade of a focused “death by a thousand cuts” efforts from all sides, one can imagine something similar being done to China today. (Although surely 2020’s Soviet China is vastly more resilient and flexible than Soviet Russia in 1980’s)

    Add to this the abandon with which the US put for example Vietnam through total hell, including Agent Orange and napalm, “because otherwise the Russians win”, and it could be plausible enough… Unfortunately.

    That being said, about 5% of Australia’s population is Chinese people, also % 3 of Canada’s, and 2 % of America’s.

    So, if China mobilizes some of its folks to help strike back at the Anglosphericals on their own turf, what’s Plan B? Put them in camps like with the Japs back in WWII? Kick them all out? Release a deadlier plague that target only them and risk a return plague that targets only WASPs and Ashkenazis?

    I think the One Belt One Road thing hit the AngloZionist establishment much harder than we all realized. They are faced with complete irrelevance if the One Belt succeeds. They’ll only be able to control a mere half of the planet, who could settle for such humiliating terms? Certainly not God’s Chosen.

    So to them it’s a delusional “now or never/them or us” thing.

    America really needs to do something about its hijacked institutions, before it’s too late both for America’s initial ethnic demographics, and for the rest of the world. A “Northern Brazil with nukes and bio-weapons” really sound pretty crap. Dangerous too.

  42. The era of supervillains is here as Jinn equivalent automatons become available to the general public with very few barriers to entry for creation. These are nice regional weapons, but it’s the one who will design a machine that can identify and kill any or every human being autonomously, that will be our downfall. Nothing like bad coding for early automatons!

    I still prefer the theory of Chinese incompetence with their research, over a weapon that kills mostly old people – and at a nice introductory rate of 1-few% fatality (like the first income taxes!) – designed by enemies. But then again, NATO’s incompetence may stoop to lowering China’s pension bill!

    • Replies: @AB_Anonymous
  43. Rahan says:

    I have to say this is the first time I’ve read an Unz article, under which there’s an immediate flood of short negative comments.

    • Replies: @Astuteobservor II
  44. onebornfree says: • Website

    “Was the 2020 Wuhan Coronavirus an Engineered Biological Attack on China by America ?”

    Nobody knows. Any honest [to him/herself] person has to admit that there is no way to know at this time. Unless, of course , you are a scientist involved in the creation of this particular virus [assuming it is artificial].

    If we assume it is man made, at this time there is no way to know if it originated in the US or China, as both countries have biological warfare labs, and both countries have the motivation to release such a virus in China, which means that this article [I didn’t read it- just reacted to the title], is pure speculation.

    Since China has a level 4 biowarfare lab in Wuhan , where it all started, I lean towards the idea that China released the virus either by accident, or deliberately as an excuse [ in order to stamp down on increasing social unrest due to steadily increasing economic difficulties].

    But again, that is an unproven [unprovable?] speculation on my part.

    Reality Reminder:

    In any case , the Chinese government is, at the fundamental level, no different from the US government:

    “Because they are all ultimately funded via both direct and indirect theft [taxes], and counterfeiting [central bank monopolies], all governments are essentially, at their very cores, 100% corrupt  criminal scams which cannot be “reformed”or “improved”,simply because of their innate criminal nature.”   onebornfree

    Regards, onebornfree

  45. MarkU says:

    I wouldn’t doubt for one moment that attempts are being made to develop race-specific bio-weapons, why wouldn’t they?

    The Chinese do seem to have had more than their fair share of viral outbreaks in recent years.

    Some very suspicious activities have been noted, the collecting of Chinese DNA and importing dangerous pathogens into China, in neither case was the Chinese government notified.

    Some of the timings are suspicious.

    Crossing species barriers is hardly unheard of but having three other species involved is extraordinarily unlikely, especially when one of them is a fish.

    All of those things together are highly suspicious but ‘HIV insertions’ (if confirmed) would settle the matter conclusively. I know that the neocons are as dumb as a bag of hammers but surely even they would have realised that much, wouldn’t they?

  46. I think it’s possible that the neocons did this, because they invented the whole WMD bullshit to destroy Iraq, so I would not put anything past them. Well…..and Israel knew what was coming on 9/11 as well.

    Corona does seem to be a bioweapon. There have been rumors of governments working on race specific bioweapons for many years, and usually Israel is involved/accused.

    While it might seem far fetched (and insanely evil) I don’t think it’s beyond the realm of possibility.

    Note also that this site is NOT “anti-American” in any way, and it’s absurd to make such a stupid claim.

    If the hostile elite has a secret plan to wipe out the Chinese, it has nothing to do with Joe Sixpack.

    Our people might be slow-witted and uninformed, but they are NOT evil.

    • Agree: Sam J.
  47. Daemon says:
    @Whitewolf

    Domestic Politics and Geopolitics are two different things bud.

  48. Yes. Don’t let them shut you up by making state secrets of the smoking guns. The broad outline of this aggression is undeniable.

    CIA under Gates has been working on this for decades. They called their shots like Babe Ruth before they broke illegal bioweapons out of secure storage to do AMERITHRAX to us. CIA germ warfare is bigger than the Manhattan Project, too big to keep secret, so they just try to keep it deniable by decentralizing the work.

    And now the CIA regime has opened undeclared war on China with illegal weapons of the most indiscriminate sort, which defy proportionality with their exponential spread. Metallicman has astutely quoted John Bolton shitting on the rule of law, asserting arbitrary coercive prerogatives for the CIA regime. This is the most lawless thing you could think of. Undeclared war – sneak attack – was the legal justification for US use of nuclear weapons on Japan.

    The message is perfectly clear. The CIA regime is daring the SCO to retaliate with legal weapons. CIA has dispersed to hide in major cities at state fusion centers. They’re using the US civilian population as human shields, hiding behind your Mommies’ skirts, going “Ha Ha, Fuck You, Nuke Me.”

    World War III is on and you’re a good German. If the SCO can’t decapitate the CIA command, we’re all dead. Their enemy is CIA. Your enemy is CIA, hostis humani generis. Everybody’s enemy is CIA. We’ve got to kill these psychopathic fuckers before they kill us.

    • Replies: @Whitewolf
  49. Culpepper says:
    @Ayatollah Smith

    Peak Prosperity on Youtube suggests antibody resistence can be mortal in a second infection:

    @20.55

  50. This article is dated JANUARY 27, 2020, and this is FEBRUARY 15, 2020.
    3 weeks out of date in a topic that’s evolving fast!

    • Agree: Old and grumpy
    • Replies: @HelloWorld
  51. Bert says:
    @Delta G

    Revisionist analysis of historical events like the origin of WWII or the deaths of three Kennedys is public spirited in the sense of awakening Americans from their credit card induced slumber. A hysterical screed like this piece, based on no real information, is irresponsible in a continuing crisis. Mr. Unz made a great error in publishing this piece. It doesn’t even pass the logical test of why deep state elite would run the risk of Chinese reprisal. The elite are sitting pretty. The risk/reward ratio for a biological attack is extremely large. It doesn’t make sense for U.S.-based actors to do it. A third party actor maybe.

    • Agree: Sam J.
    • Replies: @bluedog
    , @Sam J.
  52. mr meener says:
    @criolle

    take your american PC style of building and shove it up your azz. it could take 5 years to get permits for a hospital enviro-MENTAL studies payoffs bribes etc. then finally turn the job over to unions who will steal loot make the job more expensive and take as long as possible

    • LOL: Biff
    • Replies: @Anonymous
  53. mr meener says:
    @Delta G

    hey POS demon from hell you can take your covering up for the CIA and shove it. go back to hell

  54. mr meener says:

    this is easy to believe being Churchill at behest of the jews started WWI cause Germany was set to pass England economically. if the Chinese find out who did this and they will they should do humanity a favor and carpet bomb Wash DC with nukes. the people there are not human they are demons from hell along with their jewish masters.
    this world is controlled by the devil thru his spawn the jews. did you see the video of that poor woman on the bicycle with the kid strapped to her back go down like that? you cant be human to cause that. remember millions being killed is human sacrifice to the devil

  55. “On October 18th the Johns Hopkins Center for Health Security, in conjunction with the World Economic Forum and the Bill & Melinda Gates Foundation, brought together “15 leaders of business, government, and public health” to simulate a scenario in which a coronavirus pandemic was ravaging the planet. Major participants were American military leadership, and certain neocon political figures.

    “The Chinese were not invited. This is unusual, as almost all the major viral outbreaks for the last decade occurred inside of China and Africa.”

    This is patently untrue, as my post #15 to Godfree Roberts’ January 28th article here on Unz made abundantly clear:
    ————–
    Godfree Roberts writes:

    “On October 18th, 2019, the Johns Hopkins Center for Health Security, in conjunction with the World Economic Forum assembled “15 leaders of business, government, and public health” to simulate a scenario in which a coronavirus pandemic was ravaging the planet. Major participants were American military leadership, and certain neocon political figures. The Chinese were not invited.”

    This appears to be incorrect. Dr George F. Gao, head of China’s CDC was not only invited, but was openly listed as a major player at this conference, one of the very “15 leaders” cited by Mr Roberts (see here: http://www.centerforhealthsecurity.org/event201/players/index.html)

    That Dr. George F. Gao is the head of China’s CDC, and one of China’s top virologists, if not the top virologist, is found here, in Wikipedia: https://en.wikipedia.org/wiki/George_F._Gao
    ————-

    Also, please note the following: apparently one of the world’s greatest experts on Corona viruses has (allegedly) informed an investor group that the novel corona virus is simply a very severe cold virus, which will almost assuredly burn itself out by mid to late spring, as corona viruses don’t replicate well in warmer, wetter environs, but flourish in cold dry circumstances, and that the corona virus will likely not become endemic, but will be a simple flash-in-the-pan: https://www.sott.net/article/429100-Coronavirus-Expert-in-Leaked-Analysis-This-is-Just-a-Severe-Localized-Common-Cold

    Of course, Dr Nicholls could be lying as part of another Western conspiracy, trying to make the east asian authorities let down their collective guards against a well-planned bio-weapons assault, but somehow I doubt a world-renowned Corona virus expert would take such a gambit in the context of his leaked comments, i.e., to a bunch of wealthy investors seeking advise on the subject at hand. Not impossible, just unlikely.

    However, the ease of transmission certainly IS something which should give us pause, and coupled with the fact it apparently targets east asians of Chinese descent, should also give rise to reasonable suspicions about its origin.

    But the Chinese government has been, and will likely continue to insist that any and all such ‘conspiracy theories’ are ridiculous, as the Chinese, even if they knew otherwise, would also know such claims would be met with ‘hails of derisive laughter’ (to quote from the famous “Bruces” Monty Python sketch), and FAR more importantly, know all too well that revenge in such circumstances is a dish served very, very cold……

    • Agree: Alfred
  56. Ko says:

    There’s a lot to read here, and I read all of it. If the virus is engineered to affect only Chinese people, I feel better and feel no need to worry about it. Though, sorry for the Chinese people, sad indeed.

    “Except China is Communist in name only, just like America is a Republic in name only.”

    I take exception to this stupid comment. I’ve had 43 Chinese students over the current and past semesters. Most of them hate their government. The most recent was a young woman who, like many of my students, approached me to tell things and answer my questions. She told me that if anyone in China comments online, in texts, or any other digital way, negatively or even remotely in a negative way about on authorities, policy, social, societal, infrastructure, or other, they get a knock on the door and questioned by state police. How is that communism in name only?

    China is communism at it’s most effective. Make no mistake about that.

    I was also told by three different students that people are getting removed from their buldings, whether the have or have not the Wuhan Virus, and they are getting put into qurantine. The belief is that sooner or later they will get sick, so they are getting fast-tracked.

    They all told me the virus is many, many times more severe with hundreds of thousands of infections and thousands, many thousands, of deaths.

    Still, it’s problematic that the US debt reached 23 trillion
    and China’s expansionist ambitions are seeing fruition,
    and the defeat of the New World Order seems imminent,
    and the survival of the United States depends upon increased manufacturing,
    and the globalists seemed to have perpetrated the globalism hoax as millions of third world boys
    and men invade white countries,
    and the dollar needs to be secured
    while Wall Street is about to collapse as the Fed feeds it 60 billion a day to keep fat rich swine
    well fed
    and well, China is Public enenky NUmber One
    So, if it’s China catching a cold, and the rest of us get to surive a while longer, so be it.

    • LOL: Ko
    • Troll: Ber
    • Replies: @ploni almoni
    , @Naill
  57. Anon[112] • Disclaimer says:

    One of the key features of the conspiracy is that the virus “seems to only infect Chinese people.” There is an easy explanation for this: all viruses are transmitted through human contact, and non-Chinese people aren’t hugging, kissing, touching, etc. Chinese people very often.

    I am basically a recluse, and guess what? I never get sick.

    As for the swine and avian flus, these things are always going around. Every new outbreak is novel, this is nothing new. They are always sharing RNA with other flus and infecting more people.

    It is rather depressing that such a large percentage of commenters read an article like this, with such spotty logic, and instantly buy the rather extreme conclusion. I guess it shows something about the gullibility of humans.

  58. Is the American deep state that good in being a perfectly timed evil? Wasn’t the deep state designed to assist multinational corporations in stealing foreign resources? Yet the corporate supply chain is being interrupted in what will be devastating for the bottom line. The stock market is about all Trump has. The scenario outlined above just quite doesn’t add up, despite its plausibility. Unless it is not about China, but purging Trump….maybe?

    • Replies: @Sam J.
  59. Whitewolf says:
    @Ei warum, ei darum

    What makes you think the Chinese would hesitate to attack civilian populations in the US if it’s own were under attack?

    I don’t buy the CIA being responsible for this. It’s too crazy even for them. There’s some lines you just don’t cross unless you’re already in total war. Blowing up an embassy in Serbia “accidently” is one thing. Unleashing a virus pandemic is another.

    If you’re going to speculate on the virus being a bioweapon then you’d have to consider it possible that it’s China’s version of 911. It gives the pretext for cracking down on freedom just like 911 did for the US.

  60. Mike P says:
    @Ayatollah Smith

    As soon as you have even some part of the nucleic acid sequence in hand, you can devise a PCR diagnostic procedure within days.

    The CT scans are not relevant to the causal diagnosis, but rather for judging organ involvement and severity.

    • Replies: @last straw
  61. Republic says:

    Why wasn’t this article with plagiarized materials resubmitted to “metallicman,”
    to corrrect and to give proper attribution to larry Romanoff of Global Research?

  62. @criolle

    They are basically prison cells..

  63. Anon[263] • Disclaimer says:

    Our media in China now focus on the battle with the virus.
    Our government now focus on the battle with the virus and restart the economic.
    Responsibilities, blames and revenges are not tier 1 urgent issue currently.
    Some of us heard these conspiracies. We believe relative departments/organizations started their job to do the research and investigation about those conspiracies. We are 1.4 billion people, capable of multitasks.
    Nasty evils just keeping refresh their dirty record, beyond any limit, commit any crimes.
    Stupid minions cheers and celebrate without any brains to realize their own tragedies.

  64. “It’s like that narrative the Trump hired low-class strippers and asked them to pee on a hotel bed. You might not like Trump, but this does not fit his personality.”

    I must disagree strongly here.

    Trump absolutely LOVES being pissed on……… by zionists.

    (Sorry, but I just couldn’t resist that one….. )

  65. Montefrío (31.) says: ” Could also be a Chinese weapon gone wrong, no?”

    No. Nobody designs a race-specific pathogen that attacks only themselves. Can you imagine Israel designing a biological weapon that kills only Jews?

    The original source of that foolish story was tracked down to Radio Free Asia, a CIA propaganda conduit that now reports to the Board of Broadcast Governors and Mike Pompeo. A similar story was propagated by the same source about SARS, when opinions began to emerge that this virus was also created in a lab.

    41.Anonymous[278] • Disclaimer says: “Yes, it was man-made. By the Chinese. Because it was engineered in the Beijing Institute of Virology.” “It is confirmed again that SARS escaped from Chinese BSL-3 labs.”

    See my note just above. There has never been any ‘confirmation’ that SARS ‘escaped’ from anywhere. Comments like these are merely thoughtless speculation based on wishful thinking.

    46.onebornfree says: • Website “both countries have the motivation to release such a virus in China . . .” “Since China has a level 4 biowarfare lab in Wuhan , where it all started, I lean towards the idea that China released the virus either by accident, or deliberately as an excuse [ in order to stamp down on increasing social unrest due to steadily increasing economic difficulties]. But again, that is an unproven [unprovable?] speculation on my part.”

    No offense, but no thinking person would make such foolish accusations as China releasing a bio-weapon to kill its own population to reduce social unrest. Homeland Security would pay a trillion dollars for a pathogen that would exclusively target ‘Occupy Wall Street’ protestors, leaving others unharmed.

    China had no social unrest at either time, not from economic difficulties nor anything else. Repeated surveys by Gallup, Pew and others document that at least 85% and often 95% of Chinese fully support their government.

    And Wuhan does not have a bio-warfare lab. I know well the Wuhan Institute, and it is simply part of the University doing biological research on human diseases in conjunction with the WHO and other such agencies around the world. Wuhan has never been associated with military research in any context. These are undocumented claims originally made by the CIA’s Radio Free Europe and then unthinkingly plastered all over the internet. They are false in entirety.

    • Replies: @onebornfree
    , @Anonymous
  66. It was a biological attack on China and has more dire consequences for China than a nuclear attack, the globalist demons from hell have shown who and what they are by this attack on humanity and the perpetual wars that they have had America involved in, these creatures are not human, and are the same ones pushing the global warming scam to starve hundreds of millions and push civilization back a 100 years!

    • Agree: mr meener
    • Replies: @AriusArmenian
  67. @Parfois1

    Best article I have found on Corvid-19. It is the only one that shows a possible connect to the Trump Admin. Funny why it is not mentioned in the above article.
    https://medium.com/@BigPun/americans-will-probably-be-spared-the-worst-of-corona-virus-888c76909058

    • Thanks: Parfois1
  68. Meena says:
    @Torshammer

    America can recruit Uighur Muslim capitalizing on Muslim ‘s visceral diskihe of pig .
    Hey : you want to eradicate the protein suppliers of the Hun! Starve them! You would be free !

  69. Though this piece provides for some evidence towards the observation that the Corona-virus was an American designed bio-weapon, the actual statistics of its lethality don’t really bare this out.

    In fact, not since the Spanish Flu pandemic of 1918 has there been a single such outbreak that has taken as many lives. And that pandemic in 1918 was more the result of bad hygiene conditions (ie: war) than anything else since new research has demonstrated that the mortality of the Spanish Flu was actually very low when people had access to good health care and clean living conditions.

    The Corona-virus at this time has an approximate mortality rate of 2% and according to some reporting is now in decline.

    If this is the case than US bio-weapon makers, if this is their virus, are fairly incompetent.

    However, according to a posting by a person who actually works in the field of genetics and virology, the development of a so-called bio-weapon to date is nearly impossible due to the inability of pathogenic experts to not only isolate a virus strain but “purify” it so its foundations can be used to develop it into a more lethal representation of itself.

    And given the levels of incompetence and corruption in US military weapons systems today, it is doubtful that such a branch of work has been isolated enough from such insidiousness that it would become capable of developing such a weapon.

    Finally, many such viruses are a result of filth and the bacteria that dwells in it. In this case, as far as I have read, the Chinese have already admitted that the Corona-virus was most likely an out growth from what they call their “wet trade”, where people by live animals for magic potions and medicinal purposes.

    Of course, my own observations here could be completely wrong. However, not everything bad that happens in our world today is a result of bad actors.

    Sometimes, shit just happens…

  70. 47.MarkU says:

    “The Chinese do seem to have had more than their fair share of viral outbreaks in recent years. Some very suspicious activities have been noted, the collecting of Chinese DNA and importing dangerous pathogens into China, in neither case was the Chinese government notified. Some of the timings are suspicious.”

    Yes, the Chinese do indeed seem to have had more than their share of viral outbreaks in recent years, in each case from a new or mutated pathogen. The human ones definitely were race-specific, and Harvard did indeed collect hundreds of thousands of DNA samples illegally and then spirit them out of China.

    61. Whitewolf says:

    “I don’t buy the CIA being responsible for this. It’s too crazy even for them. There’s some lines you just don’t cross unless you’re already in total war. Blowing up an embassy in Serbia “accidently” is one thing. Unleashing a virus pandemic is another.”

    Unless you get away with it.

    Dr. Leonard Horowitz quoted one military expert as saying “Even if you suspect biological terrorism, it’s hard to prove. It’s equally hard to disprove . . . You can trace an arms shipment, but it’s almost impossible to trace the origins of a virus that comes from a bug.” Another expert stated that a properly-done release of an infectious agent cannot be traced to its source and might be considered an “act of God”.

    53.Bert says:

    “It doesn’t even pass the logical test of why deep state elite would run the risk of Chinese reprisal . . . The risk/reward ratio for a biological attack is extremely large.”

    Not necessarily.

    This subject is difficult to discuss openly in a nation of people, or even within international bodies like the UN. The infliction of such a pathogen onto a nation is clearly an act of war. However, if the leaders have not irrefutable proof of a bio-weapon and its source, and are not prepared for a military response, the only solution is to remain silent and emphasise research on defensive measures in the event of a recurrence. Even with overwhelming circumstantial evidence, a public statement or an accusation would likely be derided as yet another unfounded conspiracy theory. This is essentially the same with disclosure to the UN General Assembly or other such body; an accusation lacking conclusive proof will simply be denied.

    It is similar with the violence and terrorist acts China has experienced in Tibet, Xinjiang and Hong Kong. The American black hand was exposed in HK because the US Consul-General was photographed meeting with the rioters, and the rioters were photographed entering the US Consulate on several occasions. Funding was identified as well from US NGO sources. But, while all concerned are firm in the conviction that the same American black hand was behing all the unrest in Tibet and Xinjiang, there is no such irrefutable evidence and public accusations cannot be made. Even if China had irrefutable proof, what are the options? Press conferences? The West wouldn’t care enough to attend and the media wouldn’t cover it. Military retaliation? Not too likely. The most appropriate would be a tit-for-tat release of half a dozen pathogens in the US. Also not in the cards. Remaining options: zero.

    • Replies: @Bert
    , @Ber
  71. Agent76 says:

    Feb 8, 2020 Interview: Author of US BioWeapons Act Believes The WHO & China Are Lying About The Coronavirus

    In this interview, Spiro’s guest is Francis Boyle, who is a professor of international law at the University of Illinois, College of Law. Professor Boyle is the man who drafted the U.S. domestic implementing legislation for the Biological Weapons Convention, known as the Biological Weapons Anti-Terrorism Act of 1989, which was unanimously approved by Congress and signed into law by President George Bush.

    Feb 8, 2020 China’s “Extremely Vile” Response to Novel Coronavirus

    China’s handling of the novel coronavirus has been “extremely vile.” From an initial coverup to mass suppression, the Chinese Communist Party has used this outbreak to prove once again that human life is of little value to the world’s largest authoritarian regime, especially in light of the passing of Dr. Li Wenliang, the whistleblowing doctor who first tried to expose the outbreak.

  72. Herald says:
    @Biff

    There is hardly any reasonable doubt that the corona virus was bioengineered.

    The real question is who released it into China. The author mentions the cui bono point several times and of course this is a good starting point for tracking down the culprits.

    Clearly suspects would also need to have access to the bioengineered virus itself. A further indicator would be to look at past form in regard to the use and release of biochemical agents, either for the purposes of war, profit or experimentation.

    My list of major suspects using such criteria would be extremely short.

    • Agree: Johnny Walker Read
    • Replies: @Twodees Partain
  73. Anonymous[392] • Disclaimer says:
    @Delta G

    Did you even read the article?

    This is a race based weapon, meaning it targets Chinese. White people will be infected but at a much lower rate.

    Besides, the west already has the vaccine I am sure.

  74. Anonymous[392] • Disclaimer says:
    @Almajiri

    Jesus, Anglos are the most evil people on the planet.

    • Disagree: Robert Dolan
    • Replies: @Robert Dolan
    , @Sulu
  75. Bert says:
    @Ayatollah Smith

    “53.Bert says:
    “It doesn’t even pass the logical test of why deep state elite would run the risk of Chinese reprisal . . . The risk/reward ratio for a biological attack is extremely large.”
    Not necessarily.
    This subject is difficult to discuss openly in a nation of people, or even within international bodies like the UN. The infliction of such a pathogen onto a nation is clearly an act of war. However, if the leaders have not irrefutable proof of a bio-weapon and its source, and are not prepared for a military response, the only solution is to remain silent and emphasise research on defensive measures in the event of a recurrence. Even with overwhelming circumstantial evidence, a public statement or an accusation would likely be derided as yet another unfounded conspiracy theory. This is essentially the same with disclosure to the UN General Assembly or other such body; an accusation lacking conclusive proof will simply be denied.
    It is similar with the violence and terrorist acts China has experienced in Tibet, Xinjiang and Hong Kong. The American black hand was exposed in HK because the US Consul-General was photographed meeting with the rioters, and the rioters were photographed entering the US Consulate on several occasions. Funding was identified as well from US NGO sources. But, while all concerned are firm in the conviction that the same American black hand was behing all the unrest in Tibet and Xinjiang, there is no such irrefutable evidence and public accusations cannot be made. Even if China had irrefutable proof, what are the options? Press conferences? The West wouldn’t care enough to attend and the media wouldn’t cover it. Military retaliation? Not too likely. The most appropriate would be a tit-for-tat release of half a dozen pathogens in the US. Also not in the cards. Remaining options: zero.”

    What you as a single individual can conjure up in five minutes as possible responses does not by any means exhaust the possibities that China, a superpower, could plan and execute over the next decade to retaliate. Deep state elites have children and grandchildren whom I suppose even you conspiracy theorists believe they care about. Your “logic” also presumes that separate ethnicities like Tibetan and Uighurs need to be incited to resist Chinese cultural imperialism. Get real.

  76. @Ilya G Poimandres

    >>”I still prefer the theory of Chinese incompetence…”<<

    Have you considered the version "To scare the hell out of billions worldwide" ?!
    That one, "fear and emergency"-based, in addition to its well-known "hypnotic"
    consequences, opens unlimited possibilities for all kinds of, otherwise hardly be
    welcomed, mandatory demands, checkups, vaccinations, micro-chipping, etc. etc.
    Plus, it's hard to imagine that having on the loose a "virus that's may not show itself
    in an infected person for weeks, and then can rapidly kill" will not have some
    "targeted" applications. Viruses also mutate, unlike "the Illuminati and Co"…

    • Replies: @Ilya G Poimandres
  77. denk says:

    I presume most already know [[[fukus]]] rings Russia/China with dozens of military bases , but I bet not many notice [[[sobs]]] planted dozens of bioweapon labs at Russia./China’s frontyard. ?

    The more I dig……………….

    [MORE]

    2013
    US constructed a bubonic bioweapon lab in Karsakhstan ,then…………

    An update.

    Right After ww2, fukus extracted much coveted bioweapon experiment data from the notorious uNit 731, in exchange, the Jp war criminals were let off scot free, went on to prosper in big pharma, Jp .

    Washington lost no time deploying its new found treasure in the Korean war, dropping bubonic virus, amongst others craps, on Korean/Chinese civilians.

    In later years,

    1949 [?]
    US tested syphilis on the GUatamela populace,

    1951
    US tested LSD in a French village.
    https://www.counterpunch.org/2010/05/31/top-killing/

    [MORE]

    1981
    Cuba accused fukus of dengue and swine flu attacks
    [confirmed]

    In 1985 and 1986,
    Nicaragua accused the CIA of creating a massive outbreak of dengue fever that infected thousands in that country

    1997
    William Cohen warned of risk of race specific bioweapon and Ebola attack by OTHERS.

    PNAC highlighted race specific bioweapon as a ‘useful political tool’

    2001 -2003,
    Dozens of microbiologists died in mysterious way [many happened to specialise in ‘gene manipulaton and DNA sequencing]….

    2003
    SARS1 hit Chinese mainland, Singapore, TW, HK..
    Chinese lawyer Tong Zeng accused fukus of biowarfare attack, in collaboration with the Jps,.
    [seconded]

    2008
    Indonesia accused US of bird flu plot

    ———————————-
    2010
    rEportedly,
    someone attended a Brit Masons meeting in 2005,
    they talked about using bioweapon to depopulate China, CHINA WILL GET A COLD
    —————————————
    2011
    Hillary [a mason insider] warned about ‘danger of genetic bioweapons attack from AQ’ [SIC]

    2011
    NIH sponsored scientist Fuchier disclosed study of weaponisation of H5N1.
    https://gizmodo.com/engineered-avian-flu-could-kill-half-the-worlds-humans-5863078
    ——————————————-

    Jan 12
    CDC insiders predicted a global pandemic in 2013

    22 Jun 2012
    Fuchier publicized the details of how to DIY H5N1 weaponisation

    June 25, 2012
    A comment on the Fouchier disclosure on the ‘Socio-Economics History Blog

    Why would any sane person publish details about how to weaponize bird flu? We are not dealing with sane people.

    We are dealing with people infected by the blasphemous reality of the mentally ill: Satanism. We are dealing with Illuminists-Satanists who are out to execute their agenda for depopulation, genocide, fomenting chaos, diseases, deaths, violence …. to initiate hell on earth … to prepare the way for their fake messiah, the Anti-Christ, the bringer of false peace, the white horseman of Revelation 6. They want to use bio-weapons and even race specific Bird Flu in this coming Satanic World War 3.

    This act of publishing the detail how-to of airborne transmissible virulent Bird Flu is just for plausible deniability before the western Illuminati employs it. They will say it is an act of rogue terrorists and nothing to do with their MIC
    – …………….
    [Referring to that 2005 mason meeting]

    Ex. British Military: The Illuminati Plans World War 3 in 18 – 24 Months!
    China will catch a Cold … During the nuclear ceasefire, there is planned to be a covert release of biological weapons. These will initially be targeted against the Chinese. As our source chillingly told us, “China will catch a cold”. Biological warfare will spread further, to the west.


    June 25, 2012 – Posted by mosesman

    ———————————————–

    2013
    CHINA CAUGHT A COLD, H7N9
    Chinese col accused fukus of biowarfare against China,

    2013
    fukus constructed a bubonic lab in karzaskhstan
    ————————

    2014
    YUmen city near the Chinese border hit by bubonic plague, entire city locked down,

    Ebola broke out in Africa, in the vicinity of two US biowar labs,
    Obama used the pretext to send in airborne 101 to
    beef up Africom.
    [must be another coincidence !]

    Apr 2014
    NIH sponsored scientist Ron Fouchier publicised enhanced method of H5N1 weaponisation
    —————-

    Jun 2017

    murkkan Scientists publicized their research on …
    weaponising H7N9

    ——————–

    2018
    CHINA CAUGHT A COLD
    hit by H7N9 again,
    almost wiping out its poultry industry.
    =======================

    2019
    China hit by swine flu,
    Pig farms nation wide were sprayed with swine flu virus by armies of professionally modified drones. !

    China forced to buy pork from US again !

    ==============================
    2020 jAN
    Bill Gates warned about ‘global pandemic’.

    2020 Feb,
    CHINA CAUGHT A MASSIVE COLD,
    hit by SARS2, AND H5N1

    —————-

    Ian Fleming’s law of probability + basic logic +
    circumstantial evidences + fukus track record
    =====> bioweapon attack !

    [[[sobs]]] = [[[deep state]]]

  78. Bert says:

    If you consider cui bono for this article, then clearly it only serves the interests behind the anti-White narrative.

    • Replies: @annamaria
  79. onebornfree says: • Website
    @Ayatollah Smith

    “no thinking person would make such foolish accusations as China releasing a bio-weapon to kill its own population to reduce social unrest.”

    Yeah right! 😂 Dream on, bubble boy!

    “Regards” onebornfree

  80. @Steve Naidamast

    The intentions of bio-weapons are not always to kill but to sometimes just cause economic damage, the virus is deadly enough to kill lots of people if it is allowed to spread freely, but not that deadly that it will cause huge death tolls if contained.

    Containment requires quarantine and this in turn means economic downturn, America is in the midst of a economic war with China and recent ‘happenings’ like the Hong Kong riots which many Western media outlets were shilling for, then it is plausible that this virus was simply America upping the ante.

    If one does go for the bio-weapon angle, then the blame must logically fall on America rather than China negligently releasing a virus from a biolab situated right near a major transit city. But I think the Western media is just using this event as an opportunity to bad-mouth China and the reporting is skewed towards hysteria to make China look like some evil USSR-esque state that could have saved thousands of lives had it just been free and democratic like the West.

    • Agree: Parfois1
  81. denk says:

    The above is just about bioweapon attacks,
    this is the full story.

    An update….

    70 years of non stop overt/covert attacks.

    [MORE]

    1950 Korean war,
    1959 Tibet,
    1962 Indo./sino war,
    1965 INdon genocide,
    1989 TAM,
    1998 Indon pogrom,
    1999 BOmbing of Chinese embassy in ex Yugo,
    2001 Hainan spy plane, Chinese pilot died.
    2003 SARS,
    2008 Tibet,
    2009 Xinjiang,
    2013 h7n9, , Asia pivot
    2014 Xinjiang, HK, Mh370, bubonic, Ebola.
    2018 bird flu,
    2019 HK, Xinjiang, swine flu…
    2020 SARS Mk2, H5N1

  82. Q:”Was the 2020 Wuhan Coronavirus an Engineered Biological Attack on China by America for Geopolitical Advantage?”

    A: Sun Tzu: Fear is the greatest tool used to control the population.

    Jon Rappoport’s Blog on “Viruses” including “Corona”
    https://blog.nomorefakenews.com/category/sars/

  83. annamaria says:
    @zimriel

    “this is an antiAmerica propaganda site in general…”

    — The author has a name and he is a true American patriot, not some Chuck Schumer or Dick Cheney: https://metallicman.com/about-me

    Do you have any fact-based arguments to juxtapose to the author’s research? It seems that the ZUSA’s current state of affairs fit you perfect. If so, then the ziocons at the Atlantic Council and (anti)American Enterprise Institute should provide a solace for you.

    • Replies: @Hail
  84. Flubber says:
    @Parfois1

    “fully functional 1,600-bed hospital”

    You mean a tent with 1600 beds where people are left to die? I’ve seen the pictures and footage from inside these “hospitals”.

    They’re sheds with beds.

    • Replies: @Just passing through
  85. annamaria says:
    @Delta G

    Why such hysterical protesting? No one forces you to read articles on Unz Review.
    As for your “scientifically strong”assurance that the US (in collaboration with Israel) cannot be involved in creating WMD, here is a food for thought: “Russians’ DNA taken by foreign agents” https://www.bbc.com/news/world-europe-41816857
    https://www.mintpressnews.com/putin-questions-us-air-force-dna-collection-ethnic-russians/233946/

    the US Air Force has issued calls for ethnic Russians to provide DNA samples for a mysterious “research” program. US Air Force Captain Beau Downey claimed that the samples were required for “locomotor studies to identify various biomarkers associated with trauma.”

    A great research by a superbly courageous woman, Dilyana Gaytandzhieva: “The Pentagon Bio-weapon:” http://armswatch.com/the-pentagon-bio-weapons/

    Pentagon contractors produce bio agents under diplomatic cover

    The Defense Threat Reduction Agency (DTRA) has outsourced much of the work under the military program to private companies, which are not held accountable to Congress, and which can operate more freely and move around the rule of law. US civilian personnel performing work at The Lugar Center have also been given diplomatic immunity, although they are not diplomats. Hence, private companies can perform work, under diplomatic cover, for the US government without being under the direct control of the host state – in this case the Republic of Georgia. This practice is often used by the CIA to provide cover for its agents. Three private American companies work at the US bio-laboratory in Tbilisi – CH2M Hill, Battelle and Metabiota. In addition to the Pentagon, these private contractors perform research for the CIA and various other government agencies.

    CH2M Hill has been awarded $341.5 million DTRA contracts under the Pentagon’s program for bio-laboratories in Georgia, Uganda, Tanzania, Iraq, Afghanistan, South East Asia. Half of this sum ($161.1 million), being allocated to The Lugar Center, under the Georgian contract. According to CH2M Hill, the US Company has secured biological agents and employed former bio warfare scientists at The Lugar Center. These are scientists who are working for another American company involved in the military program in Georgia – Battelle Memorial Institute. …

    Amongst the secret experiments, performed by Battelle at NBACC, are: Assessment of powder dissemination technology ; Assessment of hazard posed by aerosolized toxins and Assessment of virulence of B. Pseudomallei (Meliodosis) as a function of aerosol particle in non-human primates. Melioidosis has the potential to be developed as a biological weapon, hence, it is classed as a category B. Bioterrorism Agent. B. Pseudomallei was studied by the US as a potential bioweapon in the past. …

    The Pentagon: How to kill 625,000 people for just $0.29 cost per death.

    • Replies: @denk
    , @denk
  86. You cannot discuss conspiracy without citing this Illuminati card titled ‘Plague of Demons’.

    Did you see the bats?

    Did you see the building, the one that looks like Capitol Hill?

    Do you know that there’s a replica of Capitol Hill in Wuhan?

    https://www.architecturaldigest.com/gallery/china-continues-replicating-iconic-structures-from-around-globe

    • Replies: @AB_Anonymous
  87. @Hapalong Cassidy

    Why are you so obsessed with civilisation? If you and your type are no longer around and destroyed, why would you care what happens to the world?

    Dark Ages would be preferable to the decadence brought about by civilisation more civilisation means more rules = less freedom

    • Replies: @ploni almoni
    , @Stonehands
  88. denk says:

    OMFG !

    nOW YOU know where all these bird flu, swine flu, Ebola, bubonic craps come from !

  89. There are 1.3 billion Chinese. The number of deaths so far doesn’t equal even a splinter from a sequoia.

  90. denk says:
    @annamaria

    A great research by a superbly courageous woman, Dilyana Gaytandzhieva: “The Pentagon Bio-weapon:

    I was going to post a link from SOTT
    after the graphic !

  91. @Flubber


    It is a prefabricated hospital, each quarantine unit is actually a cargo container with a bed and some medical equipment in it.

    You can almost see the individual prefabricated rooms in the following photo.

    I don’t think they are actually pouring large quantities of concrete or anything like that, it is still fairly impressive that they managed to organise such a thing but it is not as impressive as it would be if they actually built a real hospital in that time, this hospital will be easily dismantled after this thing blows over and is not built to last for years. The news reports even specific it is a ‘field hospital’ built by the PLA. I am pretty sure America could do the same if it wanted to, although it would definitely set people like Alex Jones off.

  92. @Mike P

    The CT scans are not relevant to the causal diagnosis, but rather for judging organ involvement and severity.

    In the Hubei province (Wuhan is its capital city), CT scan is used for diagnosis. Exact etiology can only be found in 20-30% cases of any type of pneumonia. So in 70-80% cases, pneumonia is diagnosed clinically and treated empirically anyway. This is true for pneumonia that is not caused by 2019-nCoV also. That’s the reason why they changed the diagnosis criteria for the COVID-19 in Hubei.

    • Replies: @Mike P
  93. CanSpeccy says: • Website

    We know that “other” DNA from a secondary species is involved, this has tentatively been presupposed to be a cobra.

    This is an RNA virus. It has no DNA.

  94. denk says:
    @annamaria

    2014
    Ebola came from US biowar labs in Africa,

    Also….

    2013
    US build a bubonic lab in Karsaskhstan,

    2014
    Chinese border town Yumen raked by
    bubonic plague, total lock down.

    • Troll: SBaker
  95. @Gleimhart Mantooso

    I want the threat of nuclear madness to stop this stupid bio weapon madness. If true.

    Do you even think?

    Based on your comment history, no, you don’t think.
    you have a belief and nothing but. You are one of the lunatics.

    I want to live, not die because of retards like you or at DC.

    • Replies: @Gleimhart Mantooso
  96. Adûnâi says:

    Many in the know, believe America has two options

    As strange was it seems

    The first occurrences in December appeared.

    suddenly began telling it’s soldiers

    CNY 2020 devistation!

    Not fewer than five mistakes in one article! Do you even proofread?

    At the beginning of February, Syrian daily newspaper Al-Thawra also claimed the coronavirus and other outbreaks were part of a US-China war.

    “From Ebola, Zika, SARS, avian flu and swine flu, through anthrax and mad cow disease to the corona[virus] – [all these] deadly viruses were manufactured by the US and threaten to annihilate the peoples of the world,” the report alleged.

    Typical magical thinking spewed by the low-IQ shitskin races of the world. Do not get me wrong, I understand this sentiment – yet it is merely an expression of their genetic hatred towards Aryans and Jews. There is no point using one’s brain to understand their thoughts logically.

    If they used their brains, they would see a simple pattern – everywhere an American has gone, peace and prosperity have followed through. Everywhere where Americanism reigns, the Aryan dies, and the shitskin subhuman triumphs.* So what is to be afraid of for non-Aryans? Nothing. Their hatred is irrational as a matter of logical discourse – yet it is indeed meta-rational if one sees it as a tool of their rational racist hatred.

    *Americans could have easily exterminated Mexico, the Philippines and Japan by 1945, but instead they implemented birth control in their own whorish lands, and vaccinated the Brown children. If you fail to see this biggest of jokes, you are blinded by the Red Giant of Christian liberal humanism.

    • Replies: @Just passing through
  97. @Rahan

    The drones/trolls are out in force.

    There is even one anon who thinks killing anyone who isn’t a Christian is perfectly normal.

    Fucking insane fuckers.

  98. CanSpeccy says: • Website

    This article is quite brilliant. By inept advocacy it effectively undermines the idea that COVID-19 is a US bioweapon.

    However, it draws attention to the curious fact that anti-HIV drugs have been found highly effective against the virus. That is consistent, perhaps causally, with the finding of an “uncanny” resemblance of “4 insertions in the spike glycoprotein (S)… to amino acid residues in key structural proteins of HIV-1 “. These sequences are “unique to the 2019-nCoV and are not present in other coronaviruses”

    • Replies: @SBaker
  99. Mike P says:
    @last straw

    I don’t understand what you are trying to say.

  100. @Ayatollah Smith

    TruNews has been reporting extensively on this exponentially growing and deadly virus for the past two weeks. Naturally, they are accused of being a right-wing Christian conspiracy outfit, attempting to spread panic among its listeners, who will then spread the fear far and wide. But what if they, and this article’s writer, are right?

    • Replies: @Omegabooks
  101. CanSpeccy says: • Website
    @Gleimhart Mantooso

    This article would be more effective for the price of a relentless copy editor.

    Yes, Ron Unz should think about this. He would find that a copy editor is a harmless drudge working for practically nothing, yet able to turn dross, perhaps not into gold, but into something with a sheen comparable to that of gold.

  102. denk says:
    @Bert

    [[[0hedge]]] claims two Chinese scientists allegedly says………

  103. I have no true idea what the truth is here about this CoronaVirus, but I do think that the criminal psycho elites will use it for totally nefarious purposes–give it to ordinary Americans regardless of race, color, creed, sex; round up those who refuse vaccines and force virus-laden vaccines on them to cull the population; members of the elites will be exempt from forced vaccination; send it to Iran (and wouldn’t it be kharmic if it wound up in Israel? But it will only affect Palestinians. Right.), Syria, Iraq (except the Kurdish parts–when will the Kurds realize they are just useful idiots?), Lebanon (only the Hezbollah parts…hmmmm…another way it can reach Israel?), etc. and make the new virus so only whites get killed from it… I have no idea, but the elites in their arrogance and stupidity will use it somehow against We the People.–so sayeth the Georgia Guidestones.

  104. @follyofwar

    I’ll believe TruNews (and IsraeliNewsLive and KnowMoreNews) before I’ll believe anything the govt. says! But I truly think no one really know exactly what will happen (except God).

    • Agree: follyofwar
  105. denk says:

    Those who subscribe to the insane conspiracy theory that this is a Chinese FF on their own people,….
    are defying logic, probability and overwhelming circumstantial evidences.

    I say FUCK YOU !
    CANSPECCY AND WHITEWOLF

    • Replies: @CanSpeccy
  106. Mike P says:

    There are a couple of fresh scientific papers out that examine the nucleotide sequence of the virus. One whose full text is openly accessible is here

    https://www.tandfonline.com/doi/full/10.1080/22221751.2020.1719902

    For the most part, the virus genome fairly closely resembles a known virus stain from bats, but the surface proteins – the ones which are most important in determining host cell type and host species – show striking variations from any known corona virus; in particular, there is one short protein sequence that shows extensive mutations and deletions (gaps) when aligned to proteins from other corona virus strains.

    For your convenience, here is the protein sequence in question (as one-letter code)

    MAYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP

    You can search for it here

    https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome

    It will tell you “No significant similarity found.”

    This means that this protein sequence, or indeed anything recognisably similar to it, has not so far been observed in the wild, or otherwise been obtained and published in the open literature. It thus is unlikely to have been acquired by the novel strain simply through the exchange of gene fragments with another virus strain. This indeed suggests that the new virus may have been engineered in a laboratory.

    • Agree: Adûnâi, utu
    • Thanks: Parfois1
  107. clickkid says:

    China has been ‘winning the peace’, trading, working and investing its way up. In 2014 China’s economy overtook America’s in size on a Purchasing Power Parity Basis – which is what counts. In 2013 China ceased accumulating US Treasuries on a net basis and announced Belt and Road.

    With each passing year the US share of the world economy gets smaller. With each passing year China’s share gets larger. This has comsequences. Clearly from the point of view of the US ruling clique this cannot go on. There will come a time (perhaps it has already passed) when it will be too late to do anything about it. China is already the fulcrum of the world economy and is the leading trade partner of about 135 countries

    But what to do?

    Clearly, there is nothing that can be done economically. China is ahead in many areas of technological research and with one billion more people produces 8 times as many STEM graduates per year than the US, Trade negotiations are basically drawn. The US economy remains hollowed-out. Meanwhile the US government grows ever more desperate in the cause of its own financing – see also the astonishing situation in the repo markets.

    The pinprick strategy of stirring up trouble on the edges of Eurasia as in Syria or Myanmar also seems to have reached its limit.There are just too many advantages to too many countries to taking part in Belt and Road. Washington has admonished its vassal states for joinng the China-sponsored Asian Development Bank, but was ignored.

    Washington’s conventional and nuclear weapons are unusable. China cannot be defeated conventionally, nuclear weapons destroy us all.

    I consider that an attack with biological weapons causing immense economic damage, but with plausible deniability was quite possibly the best remaining move on the geopolitical chessboard for Washington.

    Put yourself in the position of a geopolitical ‘decider’ in Washington. Can you actually think of anything better to do with the aim of maximizing Washington’s global power (or minimizing loss of power) than such an attack. I can’t! Not to conduct the attack would have been geopolitically suboptimal. It would be like a chess-player holding of on forcing some material or positional advantage, despite seeing the opportunity.

    If there were no better move for Washington than this, then the question becomes why wouldn’t the Pentagon mount such an attack. Washington has the motive. Decades of research in biowarfare give it the means. Opportunity is merely a matter of planning.

    So far, the move has been a success. China has become literally more isolated. The economy is according to some accounts barely moving. Washington has reaped propaganda advantage.

    I still think China wins this game, but at least Washington has delayed inevitable defeat, although perhaps increasing the ultimate severity of that defeat. It has still played geopolitically, although obviously not morally, the least bad move.

    Let’s see what China’s counter-move is.

  108. Pft says:

    I’d like to see the evidence there was no Chinese participation in Event 201. Pretty sure I read elsewhere there was Chinese participation.

    Also, given Chinas aging overpopulation problem, maybe a disease which affects mainly older chinese people was not caused by an “accidental” release. Also, chinas birth rates are declining despite the lifting of 1 child policy, for economic reasons. Keeping people locked in their homes for lengthy periods should cause a baby boom this October. That will help the age demographics a bit.

    There are other possible reasons for releasing a virus or saying a virus is behind these pneumonia cases (in a normal year over 30 million people get it and 300,000 die from pneumonia in China . Check out Biolake in Wuhan and all the global/Chinese pharma and biotech companies that will profit from a pandemic . China is totally on the vaccine bandwagon and produces its own vaccines (and many API’s for the global drug and vaccine industry) with mandatory vaccines for like 17 different diseases including emergency vaccines. 1.4 billion people. Do the math. They also passed a stronger vaccine law on December 1 that will strengthen monitoring and enforcement of mandatory vaccinations.

    Another motive, ending the HK protests once and for all and a cover story for rounding up dissidents , those with low social credit scores, other undesirables and disappearing them (virus victims). Not saying thats happening but who would know if it was except the victims.

    Its very possible there is no new virus, just an exercise in terror. There is so much pneumonia around anyways. Just need an unvalidated test developed by Biolake firms that will be positive in 1% of patients tested for pneumonia , say the science is settled and doctors and scientists and everyone else will not question it. How can any of us know in the age of deceit.

    My theory is the so called conflict with China is fake wrestling. At the elite level, Chinese and Western elites are united globalists. Plenty of pie for them all the share. The fake opposition works to control their populations. As every ruling class knows, people need external enemies to blame for their problems lest they blame their ruling class. This is especially true in China where there is only 1 party (in the US people can blame the other party as well).

    • Disagree: steinbergfeldwitzcohen
    • Replies: @denk
    , @denk
  109. Alfred says:
    @Ayatollah Smith

    The tests that I am referring to are not PCR tests. PCR tests take days, plenty of skill and are expensive.

    Here is what Lieber and others have been working on:

    Electrical detection of single viruses (ResearchGate)

    Xiaowei Zhuang, Charles Lieber, and colleagues at Harvard University have detected single virus particles in real time by measuring conductance changes with nanowire field effect transistors. Single-virus detection could help doctors diagnose illnesses at very early stages of infection.In the new approach, the researchers covalently attach antibodies against a specific virus to silicon nanowires in an array format.Virus particles are delivered to these structures via micro fluidic channels. Virus–antibody binding events on each nanowire in the array are measured as changes in conductance.To ensure that the conductance changes are due to single virus particles binding to an antibody-coated nanowire, the researchers performed binding experiments with fluorescently labelled influenza A virus. These simultaneous electrical and optical experiments confirmed that conductance varied when a virus bound to or detached from a nanowire. Zhuang, Lieber, and colleagues also tested the specificity of the method by varying the antibody density. Influenza A virus particles remained bound for long periods when the nanowires were densely coated with antibody but for short periods when a low antibody density was used. These data indicate that the method is specific and that it could also be used to study unbinding kinetics.

    Nanowires detect single viruses (Analytical Currents)

    Selective detections of single-viruses using solid-state nanopores (2018)

    I hardly need add that this is a game changer for prevention. We all need this to protect us in the future from the cunts who are playing these silly and evil games.

    • Agree: denk
    • Replies: @Mike P
  110. @gotmituns

    Oooooooooooooooooooo!!!!!
    Can’t go there, someone may melt.

  111. @Anonymous

    Neocons are NOT anglos, dumbass.

  112. @AB_Anonymous

    Yeah, the Borg elephant gets frightened by the mouse! Long shot for an outsider force imo, and it’s just too close to a Logan’s Run spin off for me!

    • Replies: @AB_Anonymous
  113. denk says:
    @Pft

    pft

    I’ve called out your B.S. at MOA many times.
    I’ll tell you why you’r the biggest cunt
    out there….. tomorrow.

  114. anon[206] • Disclaimer says:

    1) This article was longer than a person’s genetic sequence.

    2) The photo of the beating from Bergen Belsen looked like it had been appropriated from a Hollywood Movie.

    3) There’s probably more lethal bacteria and viruses living in John Bolton’s moustache than there is in an average Airbus 320 aft restroom.

    4) Any western government or organization that would do this are more than suicidal themselves because they never know where the retaliation could occur and there are literally millions of potential Chinese fifth columnists living in every western country. Also there are probably more Chinese microbiologists and other people working in the life sciences than the rest of the world combined.

    5) If retaliation did occur, how would western countries round up all the millions of Chinese immigrants and foreign students in the west? The logistics of this would make the rounding up of Japanese in WW2 look like crowd control at a supermarket.

    6) Would western governments or those that act on their behalf be willing to cause massive disruption to the economy that is the source of not only all the cheap junk that is sold in the Wal Mart but so many of the other things that aren’t made in the west any more.

    7) With such massive integration of the Chinese and western economies that has taken place in the past 30-40 years, the blowback from any destruction of the Chinese economy would result in a worldwide depression that would make the 1930’s look like a slight recession.

    8) There is only one nation in the world that’s crazy enough to do something like this and we all know who that is because they have a track record of terrorism, assassinations, spying against “friends”, manipulating elections and possibly bio-warfare. They have the technology, money and perhaps even motive, but that will need to be established.

    • Agree: Robert Dolan
  115. Al Liguori says: • Website
    @Ayatollah Smith

    LET’S REMEMBER (((WHO))) SPECIALIZES IN ETHNIC BIOWEAPONS!

    Israel is Developing ‘Ethnic Bomb’ for Growing Biological Weapons Arsenal http://www.ihr.org/jhr/v17/v17n6p24_Weber.html

    • Replies: @Anon
  116. The Western elites are staring into an abyss. Imagine you are them. They managed to fundamentally shift the natural trade route that existed across Eurasia. They were at the far end from the natural riches of India. Against the odds, they rerouted that world trade system to their advantage.

    Now they are faced with irrelevance. The Chinese inspired OBOR would reverse 500 years of hard work. I see no reason to believe they would sit back and allow nature to take its course.
    China has seen over a decade of consistent viral attacks; both human and animal virii. They have had their animal and human population under threat.
    The idea that policy is implemented by government is laughable. Elites USE government; they act THROUGH government by using agents. Pomparse and Esper were the end line in a short chain that saw the number 2 in Iran assassinated. That set the tone for this whole decade.
    Act 2: Wuhan flu.
    Get ready for a very painful decade.

    • Agree: Mike P, clickkid, Herald
    • Replies: @Hail
  117. Mike P says:
    @Alfred

    The tests that I am referring to are not PCR tests. PCR tests take days, plenty of skill and are expensive.

    PCR is far cheaper, simpler, and more versatile than the high-tech stuff that you describe further down in your comment. A single PCR reaction costs mere cents to run; what some accredited labs get to charge for it is another matter, of course.

    Versatility really is key – in a routine lab, you don’t want to have a special purpose device for every germ out there if you can help it. (With some, of course, you can’t help it – example: tubercle bacilli.) PCR is applicable to viruses, bacteria, and other microbes; the reagents are cheap and fairly stable.

    Another increasingly important method is mass spectrometry – after isolating a microbe using traditional culture techniques, you just smash its molecules to smithereens and match the fingerprint of fragments against a database. This method, too, has the advantage of broad applicability.

    • Replies: @Alfred
  118. Hail says: • Website
    @annamaria

    About Me

    I am an American. I have been an American expat for some time now. I live in communist China (of all places). I’ve been living here for some time, ever since my retirement from MAJestic.

    Childhood

    I am quite typical for an American “baby boomer”. I was born in the 1950’s, and I grew up in the 1960’s and 1970’s. I graduated from High School in 1977

    One of Metallicman’s posts is: “The story about how I got married to my Chinese wife,” though in it he does not talk about when, how, or where; it is all abstract talk about Chinese culture. He dances around his own story but does not tell it, at least not there.

    It appears from other material he has posted that he had child-age children as of the late 2010s, which implies that his mixed-race children were born, presumably in China, between the mid-2000s at earliest and late 2010s; he refers to their future potential more than their present, and early-childhood-type activities, implying the latter part of that birth-year range is more likely when he was writing in the late 2010s. Metallicman’s Chinese wife, whoever she is, must be much younger than he is, probably at least 20, maybe 25 years years younger than he (b.1959?).

    He also claims in his bio that he was a member of the US Majestic UFO project beginning in or about 1980, and retired exactly thirty years after starting. He says he has lived in PRC China since detaching from Majestic, which puts him in China since about 2010, with a plausible scenario of marrying in the early 2010s and having at least two mixed-race children in the 2010s (corroborating the above) whom he is now raising in the PRC.

    Metallicman sounds like a case of “going native.” Politically speaking, and otherwise.

    • Thanks: Lot
  119. @Adûnâi

    Most Whites are subhumans, they have abandoned Nature and prefer hedonistic worldly pleasures, this is why they are going extinct by their own volition. The coloured races are completely justified in haring the Whites, the world cheers as all those Africans find their Lebensraum in Europe just as they did many thousands of years ago.

    I sometimes wonder if Whites are even real people, they certainly don’t seem like healthy organisms who wish to continue their bloodline. Perhaps Whites have evolved too much?

  120. eah says:

    One of the victims at Bergen-Belsen was this young woman, her face still bearing the scars of a terrible beating by the SS guards. The military ALWAYS censors the images of war to prevent the troops from getting “soft” towards the “enemy”.

    A couple of quick questions about this foto (I’ll accept it was taken at B-B): 1) what was the purpose of including it here?, and 2) what proof is there that the woman’s injuries resulted from “a terrible beating by the SS guards”?

    Also re this foto and the context of including it here, I don’t really understand the 2nd sentence of the caption: The military ALWAYS censors the images of war to prevent the troops from getting “soft” towards the “enemy”. — since obviously it would be much better not to censor this particular foto, as one would normally expect it to cause troops to remain ‘hard’ toward the enemy.

    Revisionists would say the conditions extant at the liberation of B-B were representative of the catastrophic collapse of Germany as a result of losing the war, and not of deliberate abuse or mistreatment of the prisoners by the Germans.

  121. Arnieus says:
    @Delta G

    That was a lot of swearing and dismissal from someone who didn’t read the article. It is true that there is no smoking gun but there is a little plenty of convenient coincidences as well as means, motive and opportunity. CRISPR technology is making DNA editing feasible and the Frankenstein nature of this virus with HIV included is highly suspicious. It is naive to imagine that the US mafia-like deep state who don’t believe they could prevail in a conventional war with the 1.5 billion Chinese or the Russia would not resort to bioweapons. That is what Russian bioweapons scientists believe. While a pandemic would drastically weaken a potential enemy, it could also serve as a scapegoat for impending economic chaos it will cause in the US. The current administration could avoid responsibility.

    Maybe you should read the article and explain why your unsubstantiated position has merit.

    • Replies: @follyofwar
  122. Mike P says:

    The Indian paper on the occurrence of HIV gene fragments in the surface protein of the new coronavirus is here

    https://www.biorxiv.org/content/10.1101/2020.01.30.927871v1

    It is flagged as “withdrawn” but still available. The retraction notice reads:

    This paper has been withdrawn by its authors. They intend to revise it in response to comments received from the research community on their technical approach and their interpretation of the results. If you have any questions, please contact the corresponding author.

    I read through it and don’t see anything wrong with it. The comments on the website don’t contain any scientific critique. Will be interesting to see if an updated and amended version actually appears or not.

    • Replies: @anonymous
  123. Herald says:

    By inept advocacy it effectively undermines the idea that COVID-19 is a US bioweapon.

    It may be rather rickety in places but overall it is a worthwhile effort and it certainly does not do what you are suggesting.

  124. Hail says: • Website
    @steinbergfeldwitzcohen

    The Chinese inspired OBOR would reverse 500 years of hard work.

    I see no reason to believe they [Western elite] would sit back and allow nature to take its course.

    China has seen over a decade of consistent viral attacks; both human and animal virii. They have had their animal and human population under threat.

    Act 2: Wuhan flu.

    Heavy on the polemics, Mr. SteinbergFeldWitzCohen, but some of us prefer real evidence over unrelated assertions that are recklessly linked together and uncertainities glossed over or covered up beneath the polemics.

    There are viruses in China + the West is worried about China = The West is causing viruses in China. Inserting the = sign there without real evidence is a blood libel.

  125. @clickkid

    It means China is at the very least free to do the exact attacks on the US population.

    So, as a person residing in a major population center in the USA, I am scared. Fuck.

    Back and forth, it will eventually lead to a hot war and nuclear war.

    Fuck the person who made this choice if it is true. Fuck them all to hell.

    This all hinges on it being true.

  126. JUSA says:

    Very long article. Needs to be better summarized. It just sounds like the author was rambling.

    If this is indeed a bioweapon, then it’s obvious this is not coming from China, as they would have no reason to make a virus that specifically targets themselves. This is from some group that wants to wreack havoc in China and get the people to topple their government, in effect doing their dirty job for them.

    One look at the fat fuck Pompeo and you know nothing is beneath him. Then you throw in his neocon chronies like Bolton, Pence, Kushner, Netanyahu, these are “ends justify means” people, no different from their controlled opposition across the aisle, Schiff, Nadler, et. al.

    US is now striking the iron while it’s hot, kicking the Chinese government while they’re down. First Wilbur Ross immediately gleefully speculated this would hasten the return of manufacturing to the US. Then US charged Huawei with racketeering and ban selling US chips to them. Mark Esper, defense secretary, gave a speech today to our Euro allies that declare China as America’s greatest threat both economically and militarily, and urged Europe to ally with US to contain China. WSJ also said today that Trump will ban export of GE’s jet engine to China. The US media is doing their part. WSJ, NYT, Zerohedge, Breitbart, American Conservative, National Review, both media of left and right kept up daily attacks on the Chinese government “lying”, “draconian”, “losing control” yada yada.

    All those who are defending the US need to realize, esp. under Trump this is no longer a “benevolent” Superpower. America is now a Jew country, thoroughly Jew controlled from top to bottom. And this is what a Jew controlled superpower looks like, completely lawless, unscrupulous, money hungry, power hungry, autocratic, extractive, destructive and morally depraved. The end justifies the means. These people will not stop until they have total control of the world, concentrate all of the world’s wealth in the hands of the Jews and have the whole world bow to Israel as its capital. Your beloved USA is no more. You are supporting a group of goons and thugs running the JU-S-A. Wake the eff up.

  127. @almondflake

    You cannot discuss conspiracy without citing this Illuminati card titled ‘Plague of Demons’.

    Well, one probably can. But those who can’t, may try to insert the following:
    “the Illuminati card game card ‘Plague of Demons’ + Coronavirus, China”
    into a simple gematria calculator, and see if the results look familiar.

  128. anonymous[340] • Disclaimer says:
    @Mike P

    Trevor Bedford compares the four ,”insertions” to RaTG13 (closest known strain to 2019-nCoV)

    I do find it strange that the Wuhan Institute waited until the outbreak (January) to publish the RaTG13 bat coronavirus sequence, which is nearly seven years after they collected the virus from bat fecal matter in 2013.

    • Agree: Mike P
    • Replies: @Mike P
    , @utu
  129. Anonymous[645] • Disclaimer says:
    @Hail

    Metallicman sounds like a case of “going native.” Politically speaking, and otherwise.

    Yes, and you and many commenters on this website are fervent White Nationalists. Not that there’s anything wrong with that. But should we dismiss what you and other WNs here say just because of your backgrounds and other views?

    What you and other WNs, and what people with other backgrounds and views like “Metallicman”, argue and claim should be viewed objectively.

    • Replies: @Hail
  130. This article is crackpot stuff. The most plausible explanation for this disease is the filthy live markets of strange animals like the known disease risk of interacting with bats. Of course it’s going to hit middle aged to elderly Chinese men hardest, most of them smoke like chimneys and have respiratory systems already in bad shape waiting for the straw that breaks the camels back.

  131. Anonymous[353] • Disclaimer says:
    @Ayatollah Smith

    “No. Nobody designs a race-specific pathogen that attacks only themselves. Can you imagine Israel designing a biological weapon that kills only Jews?

    The original source of that foolish story was tracked down to Radio Free Asia, a CIA propaganda conduit that now reports to the Board of Broadcast Governors and Mike Pompeo. A similar story was propagated by the same source about SARS, when opinions began to emerge that this virus was also created in a lab.”

    No, that’s wrong, stop making that wrong assertion.

    It’s not a ‘story’. There is a line of scientific papers starting at least from the paper in 2013: ‘Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor’

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5389864/

    These papers show that the Chinese identified and isolated naturally occurring SARs type Corona Viruses able to cross between bats and humans. In 2013 – and it’s pathway for cell entry was the ACE-2 pathway of cell surface proteins that Asians have a higher percentage of in various anatomy.

    So just to be clear – it’s not some ‘story’. Anyone can look up that paper and then find all the citing papers that were subsequent. These show that the Chinese identified an ACE-2 pathway Corona-Virus, and then subsequently developed it from 2013, including engineering Chimera Viruses that contained other properties. It looks like they were trying to develop a vaccine.

    It’s not about creating a race-specific pathogen targeting Chinese. It’s about a line of research studying cellular entry of a Corona-Virus originating in Chinese bats that could transmit to humans without an intermediary. A line of research that was lauded by the Chinese as evidence of their superior research prowess. Why are people trying to pretend it never happened?

    Anyone can look at the paper – so I’d suggest calling it a ‘story’ isn’t accurate.

    [MORE]

    “See my note just above. There has never been any ‘confirmation’ that SARS ‘escaped’ from anywhere. Comments like these are merely thoughtless speculation based on wishful thinking.”

    That’s a statement of Chutzpah given the context of this article which is a shambolic smorgasbord of thoughtless speculation based on wishful thinking by a man who thinks he’s in ‘Dances with Wolves’.

    Also: https://www.sciencemag.org/news/2004/07/sars-crisis-topples-china-lab-chief

    ‘Never Confirmed’

    “SARS has sent the head of another top official in China rolling. Yesterday, director Li Liming of the Center for Disease Control and Prevention (CDC) resigned, along with several lower-ranking officials, after a report by a panel of experts blamed China’s most recent outbreak of severe acute respiratory syndrome on a series of flaws at the CDC’s National Institute of Virology in southern Beijing.”

    The outbreak earlier this year, which sickened eight people in Beijing and Anhui Province and killed one (ScienceNOW, 27 April), started when two workers at the CDC lab, independently from each other, developed SARS. The most likely source of their infection, the report concludes, is a batch of supposedly inactivated SARS virus that was brought from a high-containment facility into a low-safety diarrhea research lab where the two were working. Apparently, the inactivation process–adding a mix of detergents to the virus–did not work properly, according to the study, of which only a five-paragraph summary has been released. In a breach of standard safety procedures, the researcher who carried out the inactivation–identified only by a family name, “Ren”–had not tested whether the virus was truly inactive, according to the panel.”

    ‘Never confirmed’.

    Except it was confirmed – by the Chinese. That’s why they fired Li Liming. That’s why they literally confirmed the likely safety breach that caused the release.

    If that outbreak was caused by procedural irregularities, why not any others? Why not this one? It was confirmed. Stop saying things that aren’t true.

    “No offense, but no thinking person would make such foolish accusations as China releasing a bio-weapon to kill its own population to reduce social unrest.”

    https://www.theguardian.com/world/2013/jan/01/china-great-famine-book-tombstone

    The Chinese killed 45 million of their own people in part to quell social unrest – in fact for even less that that. So Mao, under advice from his Jewish advisers like Israel Epstein et al could save face by exporting grain in return for completely useless Soviet arms.

    Jews hate white people. Jews hate Chinese people. Jews have conducted Holodmor’s against both. Mao was just a willing participant.

    It is getting really, really tiresome hearing all these pathetic bromides about how the Chinese are angelic scions of virtue and couldn’t possibly do all the things they’re on record as doing.

    This is starting to sound like the people who were calling the Soviet Union a paradise.

    “China had no social unrest at either time, not from economic difficulties nor anything else. Repeated surveys by Gallup, Pew and others document that at least 85% and often 95% of Chinese fully support their government.”

    But I thought that China was facing serious Islamic and Tibetan insurgencies fomented by the evil Americans? I thought China was facing a Hong Kong rebellion?

    https://www.straitstimes.com/asia/east-asia/no-let-up-in-xi-jinpings-hunt-for-tigers-flies-and-spiders

    So the Chinese were entirely in support of their government, and there wasn’t even a ripple of dissension in the still lily padded waters and rice paddies.

    But Xi has imprisoned, had executed, or bankrupted as of 2017 1.3million Tigers, Flies and Spiders – and that process has continued unabated to the present time.

    https://mobile.abc.net.au/news/2020-01-16/china-top-banker-lai-xiaomin-stashed-42-million-cash-in-cabinets/11869762?pfmredir=sm

    They’re still being imprisoned, bankrupted and gassed.

    So in that context, 85%-95% of Chinese support their government. Well why wouldn’t they. If they don’t, they might be branded a Tiger, or a fly, or a spider, or perhaps a moth going down the line of the hierarchy of insects.

    ‘No social unrest’.

    “And Wuhan does not have a bio-warfare lab. I know well the Wuhan Institute, and it is simply part of the University doing biological research on human diseases in conjunction with the WHO and other such agencies around the world. Wuhan has never been associated with military research in any context. These are undocumented claims originally made by the CIA’s Radio Free Europe and then unthinkingly plastered all over the internet. They are false in entirety.”

    No, that statement is false in it’s entirety.

    Dual-purpose research, for the umpteenth time, makes redundant any specious distinctions between ‘research’ and ‘military research’.

    These are not undocumented claims – anyone can look up once again on various research databases the kind of research being undertaken at the Wuhan facility with dual-purposes. A virus like this wouldn’t have to be a weapon. It would just need to be a substance held in a facility that was unfit for purpose subject to the same kind of errors that caused a SARs outbreak in 2004.

    Again – the Chinese put a BSL-4 facility in what looked like a derelict Apartment building and for some reason you can’t view it anymore on Google Maps.

    We know such substances have been held in Chinese facilities for a long time – but certainly since 2013. Had that Bat-Corona Virus escaped at the time it could easily have led to the current situation. It would have held the same supposed Asian susceptibility due to the ACE-2 cell entry, possibly the same problems with long incubation etc.

    Evidently this culture has been developed further. I’ve seen terrifying theories that this virus as well as having HIV immune effects might mimic a bacteriaphage. That is, a virus that can trasmit via infection of bacteria and archaea. If that’s the case, and that would explain why the Chinese are spraying every surface they can, this is an even more serious event then anyone thought. So serious that people should start considering getting their affairs in order.

    Viruses mutate with each generation of infection, within the R-0 cycle.

    So lets forget about the fact that the US military can’t even build a rifle (the M16) or a plane (the F-35) let alone a race-specific virus. Even if somehow they could, and were insane enough to deploy it, it would be suicide. Because viruses can mutate, particularly in a Pandemic.

    All the western nations are just a bit behind China on the curve. If the incubation time is somewhere in excess of 28 days.

    https://www.zerohedge.com/health/why-government-turning-11-military-bases-inside-us-quarantine-camps

    Indeed – why is the US government preparing military bases to act as quarantine zones in the United States? If white people are immune to this disease, and Hispanics and Jews and all the other diversity fake-American Not-Americans in the United states are immune, these quarantine bases are totally unnecessary.

    I’d encourage people to look at the line leading to the City of London Corporation, Soros and his backers, and understand the financial system changes currently underway that might have caused them to seek to disrupt the international economy.

    https://www.americanmanufacturing.org/blog/entry/china-is-quickly-becoming-the-worlds-pharmacy-and-that-comes-with-great-ris

    People act like opposing ‘Made in China 2025’ is some kind of evil racist plot against noble Confucians just seeking their destiny.

    What does that actually mean?

    https://www.washingtonpost.com/opinions/we-rely-on-china-for-pharmaceutical-drugs-thats-a-security-threat/2019/09/10/5f35e1ce-d3ec-11e9-9343-40db57cf6abd_story.html

    90% of US generic pharmaceuticals come from China, and whatever doesn’t come directly from China comes from India. What Indian get as active pharmaceuticals in turn comes from China.

    So that means within the social credit framework that if you don’t volunteer your beautiful European wife to get raped by Wang No-Fang the Chinese can cut off your anti-biotics, your hypertension medication, your heart medication, your diabetes medication etc.

    It’s bad when ‘any’ kind of totalitarian gets a monopoly on vital strategic resources, whether it’s evil vile Jews, or evil vile Chinese, or evil vile Anglos – why don’t people here look at who has been engaged in obtaining private monopolies over water rights and aquifers all over the world.

    Americans are one of the most medicated populations in the world. Of course, the Chinese wouldn’t be putting in additives into those generics to poison Americans, or anything.

    https://www.npr.org/sections/health-shots/2019/05/16/723545864/the-generic-drugs-youre-taking-may-not-be-as-safe-or-effective-as-you-think

    Just like they didn’t sell their own citizens baby-milk powder made out of ground lead and cyanide and asbestos.

    But it seems madness again to jeopardize your own population. Even assuming China acted entirely in good faith, if China is crippled it will mean American’s won’t be able to get access to their medications. Some might say the US establishment is that cynical – and they’re right. But Trump isn’t, not in an election year.

    https://www.abc.net.au/news/2019-11-27/university-of-wollongong-professors-linked-to-high-risk-schools/11741450

    The Canadian experience isn’t unusual. Chinese espionage, theft, sabotage and exploitation is absolutely rife in Australia – here Chinese military agents used the University of Woolongong to steal Australian national security IP to take back to China.

    What I find amusing is the very clear acceptance in this article that Chinese researchers in Canada were stealing IP and acting as traitors and agents of the CCP as a matter of course..

    The implication seems to be that Chinese engage in espionage so much, that firing them for the espionage is actually nefarious because it prevents the espionage.

    Just like if you punish Chinese students for cheating – 90% of them, it’s nefarious because that means it’s an unfair playing field because everybody cheats.

    There are much better arguments to be made. These are very weak, pathetic arguments that undermine the better arguments.

    I can easily imagine the Israelis actually creating a weapon to target goyim but there being some kind of malfunction at the stage of prototyping based on Ashkenazi genetic signatures.

    https://thenextweb.com/security/2020/02/11/data-of-all-6-5-million-israeli-voters-reportedly-exposed/

    Israel just left all the personal details of their entire population available on the web in you clicked once. They self-doxxed their entire precious Jewish population.

    So yes, I could easily imagine Israel using samples of their own people to create a weapon and then accidentally releasing it before it reached the stage of targeting gentile genetic signatures (i.e. non Sephardic, Ashkenazi whatever). Just like I can easily imagine the Chinese doing it as well.

    It will be awfully unfair on everybody if the Chinese unleash bio-weapons on western countries because they made a mistake. And if they trace it to specific individuals, I’m sure targeted strikes are an option. Where is George Soros these days? He really hates China. He had an office in Wuhan. He wants to flood China with Africans, same as the West. One world government only works if ‘ALL’ the races are homogenized.

  132. @Mike P

    Thank you.
    This is precisely the type of information that needs to be highlighted. Many of us lack a hard science background. I do. I can’t evaluate competing claims.
    I, like many others, am in the position of scanning enough sources to try to arrive at some level of truth. The Propaganda outlets of msm won’t do that for any of Us.
    I did a lot of reading on this in mId-January to late January. All the sources I came across that pointed towards truth were ignored or mocked or attacked. Slowly, I am seeing sources I read weeks ago fermenting and popping up in articles like this.
    The minimization of this ‘just a flu’ and the false claims of origin from bats remind me of the instant answers propaganda outlets had in September, 2001.
    Again, thanks

  133. Mike P says:
    @anonymous

    It seems Bedford is right – there does seem to be an older bat virus strain that has similar “insertions.” So this part of the story can be considered falsified.

    The question of that novel protein mentioned in my earlier post remains, however.

    • Replies: @anonymous
  134. Hail says: • Website
    @Anonymous

    The commenter annamaria, above, wrote:

    The author has a name and he is a true American patriot, not some Chuck Schumer or Dick Cheney

    annamaria’s comment was intended to mean that one should be skeptical of claims made by Chuck Schumer or Dick Cheney because of their potential ideological biases, perhaps in general but certainly on controversial subjects close to their core ideological commitments. That is what I take annamaria’s comment to mean, and I would agree.

    Knowing an author’s potential biases is useful. To take an extreme case, imagine an article examining a newly formed charismatic religion which claims to have a new revealed truth, quasi-divine status for the leaders, and demands loyalty from members (one might call it a “cult”). Imagine said article was written, unbeknownst to the reader, by a longtime core member of the group. Useful to know? Not useful to know?

    annamaria’s characterization of Metallicman’s background, therefore, is far from the full story, which is why I posted what I did. Her line “true American patriot” glosses over, entirely, the highly relevant facts of Metallicman’s long residence in China, his Chinese wife, his half-Chinese children, and his seeming full embrace of the PRC. He appears to be a ‘lifer,’ and therefore in a sense an ex-American, regardless of what his passport says on the front. Annamaria’s characterization commits sins of omission and arguably also of commission (ex-American vs. American).

    I think I have characterized Metallicman’s background fairly, using his own words. He is very close to his subject here.

    (Tangential but related to fawning admirers of the PRC: Godfree Roberts, an Unz Review regular. To my mind indistinguishable from a paid agent of the PRC state media. He posts their talking points uncritically and aggressively. Unz Review commenter Achmed E. Newman, who has experience on multiple, extended business trips to China, has repeatedly asked Roberts, apparently resident in Southeast Asia, if Roberts has ever lived in, or even set foot in, the PRC whose state-media talking points he pushes so much. To my knowledge, Roberts has never responded to Achmed E. Newman’s queries.)

    • Replies: @Anonymous
  135. Anon[234] • Disclaimer says:

    Pot smokers are in danger. Not only does pot smoking damage the lungs, THC suppresses the immune system. They’re going to die at the same rate that Chinese smoking males do.

    You can wave goodbye to the Libertarian movement in American politics.

  136. utu says:
    @anonymous

    Trevor Bedford is a useful shill who quickly got himself quoted by MSM. The proofs of impossibility are difficult except for trivial mathematical cases but in real life scenarios often are not possible. All Trevor Bedford could do would be to provide a quantitative analysis, which he does not do. What is probability of the inserts occurring by natural mutations versus what is know probability of natural mutation rate for a single nucleotide. The latter is imputed and thus assumed. So can he claim that it is impossible that the 2019-nCoV was modified, augmented, improved, beefed up, engineered in lab? No, he is in no position to claim it.

  137. @gotmituns

    Of course not. If the Kalahari Bushmen had been transported to the magic islands of Japan, they would’ve created the vehicular superpower of Toyota, it just would’ve required a clicking sound be incorporated in to the pronunciation.

  138. @anon

    Agreed.
    RE: 8
    Richard Steele, ex-CIA, stated recently on the SGT report that ‘Zionist’ elements are the most likely offenders.
    I agree. Their horse is sick (America). So, simply put, they poison the other guy’s horse.
    ‘If I can’t win this race then neither can you’. <–This is the mentality.
    They like assassinating people. Dr. Plummer, Canadian microbiologist and employee at Winnipeg L4, suddenly died in Nairobi.
    This Chinese viral outbreak has Israel written all over it. Just like Soleimani, vicious and immoral behavior is the Israeli 'tell'.
    Whether any proof of that comes forward…we are still left wondering about 911. We could very well never have proof of this one.

    It is pretty hard not to notice that all the methods used by Israeli's to get a country are now being used to maintain their dominance over America and the world system. Assassination, genociding, economic warfare, tainting pharmaceuticals, poisoning water supplies….any and all forms of nasty seem to be okay with a certain tribe. These same people have gamed the U.S. political system so that they always get their people elected.
    How soon before a critical mass exists to end this Jewish tyranny? There is a huge pent-up demand for ethical governance and an ethical international system.
    I for one, hope we don't go past a point of no return.

    • Agree: Sam J.
  139. Anon[234] • Disclaimer says:
    @Mike P

    Unfortunately, how much do Chinese scientists know about bat viruses? It could just be an honestly novel and natural bat virus that was previously unknown, because let’s face it, the Chinese learned most of their medicine and science very late in comparison to Western countries. Chinese scientists most certainly have NOT had time to examine every form of animal life in China for novel viruses, and there may plenty more still unknown there.

    Modern China, with its massive and very dense population, and the massive movement of its peoples within its own borders and around the world, was a pandemic just waiting to happen. If not COV19, some other virus would have done this. It was just a matter of time.

    • Replies: @clickkid
  140. Lot says:
    @Hail

    You missed one highlight:

    “ As such, I was provided with certain operations and probes (placed within my brain). This enables me to alter my reality; my world-line. Further, I was provided with training that permitted me to do certain tasks associated with my objectives.

    Probe insertion and implantation occurred at two facilities. Training was conducted on the base.”

    • Replies: @Anonymous
  141. @Hail

    These are conclusions.
    I’ve been reading about Wuhan 400 since mid-january. I wanted to find out what, where, and why. I saw a ton of evidence that indicated that the West has been developing bio-weapons and using them since the Korean War.
    China has been hit with a variety of virii targeting food stocks-pigs and chickens- and humans-SARS, HxNy and now Wuhan.
    I don’t have to do your homework. I did mine and I drew conclusions.
    Wuhan 400 is a bio-weapon and it was released.
    Read my other comments.
    Can I prove it. No. Do I have to? No, I don’t. We all draw inferences every day based on the patterns we see around us. We factor a variety of pieces together to solve the puzzle.
    I noticed a pattern. China, the only economic competitor of the U.S., that is openly working towards returning the world to a trade system that existed for a really long time (the Eurasian Silk Road) is under attack.
    The average Chinamen will not buy that their government did this to them. I don’t. Why should I?
    They may run a dictatorship but they aren’t morons.

    • Agree: clickkid, Alfred
  142. @Arnieus

    Mad Dogs like John Bolton, whom the writer mentioned several times, don’t give a shit if the world’s economy goes down as a result. It can be built back up, and the victorious USA will be stronger than ever, witness the Marshall Plan after WWII. China could be sent back into subsistence farming.

    I doubt very much if Trump is part of it. With his tweeting addiction, he can’t keep his mouth shut. The decisions were made well above his pay grade. We live in a Mad House! A Mad House, I tell you!

  143. eah says:
    @Mike P

    This means that this protein sequence, or indeed anything recognisably similar to it, has not so far been observed in the wild, or otherwise been obtained and published in the open literature.

    OK — but just because it hasn’t been “observed”, doesn’t mean it hasn’t been extant “in the wild”, perhaps for some time, right? — that possibility is also ‘suggested’ — I doubt corona viruses or viruses found in bats are under constant, detailed genetic surveillance.

    Development of resistance to ABs in bacteria is a well-known phenomenon — if some organisms possess natural resistance to an AB, use of that AB can select for these organisms, resulting in widespread resistance — or organisms can develop resistance via genetic changes, and these changes, when passed to other organisms, can also result in widespread resistance — clearly this latter mechanism is natural, and involves first a mutation that has “not so far been observed in the wild”.

    I have no idea whether 2019-nCoV is man-made or not, or if so, if it represents an intentional ‘weaponization’ of an existing virus — or, going further, if the current outbreak, said to have originated in Wuhan, represents a hostile use of a ‘weaponized’ virus — but I don’t find your logic entirely convincing.

  144. What’s really tough to figure out is how the Americans managed to engineer the black plague. People say that it originated in the far east but, that would mean that the hygiene & food consumption practices required to have a nation became essentially a gigantic petrie dish to allow evolution to create such a horror, would have to already exis….. oh wait.

  145. @Astuteobservor II

    I was making a point, dumb-ass. Not literally advocating for nuclear war. Do YOU even think?

    • Replies: @Astuteobservor II
  146. Anonymous[322] • Disclaimer says:

    Given the strings of coincidences, and the US’ actions in the last few days re: relentless media attacks, Wilbur Ross, Huawei, Mark Esper’s speech to Europe and banning of jet engine sales to China, it is certainly very possible that this was a US engineered bioweapon designed to create chaos in China and bring down the Chinese “rogue” regime that refuses to kowtow to globohomo’s every wish incl. control of their central bank.

    If this means a total decoupling of Western economies from China, that may end up being a good thing. The Chinese have been rather too globalist and arrogant of late. There isn’t a corner in the world you could go without seeing a Chinese face. From Africa to South America, All of Asia to Europe, Middle East to Oceania, Chinese tourists, “students” and immigrants are practically wholesale invading the world. Wherever they turned up in large numbers, they are roundly despised, yet they continue to wash up anyway. So they don’t have too many real friends to begin with. Now this coronavirus will make them even more despised everywhere. If this hit to their economy stops their invasion of the world dead in the tracks, keeps the world from being swamped by Chinese invaders, it may not be all bad.

    My fear is this will backfire. If the government collapses it’ll send these people scurrying overseas by the millions claiming “refugee” status.

    • Replies: @Anonymous
  147. Anonymous[223] • Disclaimer says:
    @Hail

    Knowing an author’s potential biases is useful. To take an extreme case, imagine an article examining a newly formed charismatic religion which claims to have a new revealed truth, quasi-divine status for the leaders, and demands loyalty from members (one might call it a “cult”). Imagine said article was written, unbeknownst to the reader, by a longtime core member of the group. Useful to know? Not useful to know?

    “Useful” for what? Things are only “useful” in relation to a particular purpose. Your purpose appears to be an intense interest in race and white racialism. If the article had been about, say, ice cream, the author’s racial background would have been useful to you because that’s your chief interest.

    Tangential but related to fawning admirers of the PRC: Godfree Roberts, an Unz Review regular. To my mind indistinguishable from a paid agent of the PRC state media. He posts their talking points uncritically and aggressively.

    Roberts is longwinded and tedious, but he makes very clear claims with little obfuscation, and cites copious references. You can object to the logic of his arguments, or dispute his assertions by rejecting his sources. Many, if not most, commenters here seem to do so.

    At any rate, you didn’t address my original point. People have various backgrounds and biases, including yourself and many other commenters at The Unz Review that are fervent White Nationalists. If we were going to reject anybody’s views simply because of their background, we’d have to reject everybody’s views at the outset.

  148. Anonymous[322] • Disclaimer says:
    @Anonymous

    Just to clarify I think it is horrible that so many are dead from this virus, and the US needn’t resort to such evil and drastic means to force a decoupling. But a complete decoupling of US-China economy has become necessary at this point. In the end it may be the US that needs to be starved to death to rid ourselves of the Jew menace.

    • Replies: @Anon
  149. JohnF says:

    “That the United States will risk World War III, using nuclear weapons, by launching a coronavirus inside China during the 2020 Chinese New Year celebrations?”

    Just like the Obama 2014 Ukraine Coup that almost started WW3 with Russia as Putin Warned.!!!!!

    Permanent War Mode – “Initiated with the 9-11 attacks.”

    This is a memo that describes how we’re going to take out seven countries in five years, starting with Iraq, and then Syria, Lebanon, Libya, Somalia, Sudan and, finishing off, Iran.” Gen W. Clark

    Every President is following the same Plan since the ‘Skull N Bones’ Bush’s ‘New Pearl Harbor’ 911 Staged Event

  150. @Gleimhart Mantooso

    What point? That USA can shoot back? We all know that dumb fuck. That is why it is MAD.

    Obviously Chinese nuke numbers isn’t enough of a deterrent anymore for insane fucks like you.

    If you want to die, don’t take me with you.

    Kindly fuck off and off yourself and leave all of us alone.

  151. Anonymous[271] • Disclaimer says:
    @Hail

    If I’m not mistaken, you’re a proponent of the White genocide hypothesis, which is the view that US/Western elites are engaged in a decades long process to genocide the White race.

    As bad as this outbreak may be, it is nothing like a genocide. It kills mainly the old and infirm, with fatality rates at low levels compared to genocide. Its effect is primarily in the economic, political, geopolitical damage it causes to China.

    If you believe in the White genocide hypothesis, why would you find the hypothesis that this could be a US bioweapon attack to be prima facie implausible?

    • Replies: @Priss Factor
  152. whats the story here…how much credit can we allocate to Ron Unz for integrity?

    I dont know Ron Unz ,new to this website…so those who know him long enough would be able support or deny if I claim that Unz would not have posted this up, were he not convinced by evidence he has somewhere that it is more than less credible..and that his site could get into no trouble by having indeed posted it up

    • Replies: @Wally
  153. @Ilya G Poimandres

    “Long shot for an outsider force…”

    Does it mean you still think that September 11 2001 attack was what it officially was ?!
    If “Yes”, I have no more questions. And if “No”, then what makes the 2020 Coronavirus
    outbreak immune to global conspiracies ? Is it a mere hunch or something else ?

    • Replies: @Ilya G Poimandres
  154. eah says:

    A general question for those who believe that 2019-nCoV is a weaponized virus (I say believe because I am not aware that there is sufficient hard evidence to conclude that it is):

    Where did the template of pathological genetic changes targeting Asians, perhaps even specifically Chinese, come from?

    Is there a similar, naturally occurring virus that is known to only affect Asians/Chinese, producing the same (or comparable) symptoms to those seen in patients infected with 2019-nCoV? — i.e. a similar virus whose pathological genetic sequences were known, and could have been introduced into 2019-nCoV?

    Or were the variant sequences in 2019-nCoV that are known/thought to result in illness (apparently only affecting Asians/Chinese) somehow developed or invented to be inserted into some variant of corona virus in order to weaponize it (against Asians/Chinese)? — if so, how was this weaponization tested before its (apparent) use?

    • Replies: @nsa
    , @Mark R
  155. @Anonymous

    If I’m not mistaken, you’re a proponent of the White genocide hypothesis, which is the view that US/Western elites are engaged in a decades long process to genocide the White race.

    It’s better called WHITE NAKBA. It’s not about wiping out the white race from the face of the Earth but dehumanizing and reducing them for a defeated and cucked people… much like the browns in Latin America who seem to be permanent peons of the Latin elites.

  156. Zumbuddi says:
    @clickkid

    March 24 1933
    Judea Declares War on Germany

    Redux

  157. Anon[396] • Disclaimer says:
    @Anonymous

    Come again?

    Starve to death the American host to kill the Jewish virus?

    Hope you don’t work for my HMO.

  158. Wally says:
    @ben sampson

    IMO, Ron Unz routinely publishes material that he doesn’t necessarily support.

    I assume he wants to keep his readers on their toes.

    • Replies: @Weston Waroda
  159. The UN includes in its definition of “genocide” the creation of conditions likely to lead, in whole or in part, to the elimination of a national, racial, ethnic or religious group. The counterargument that non-Jewish whites are “not a racial group” can be refuted both with DNA evidence and by pointing out the existence of concepts such as “white privilege” and “white supremacy” as well as the existence of affirmative action programs that discriminate against whites. Proof of “elimination” can be supported by the following facts: 1) without the explicit permission of whites, and often on the basis of deception, massive non-white immigration has been taking place into majority-white nations; 2) whites have been forced against their will to integrate with non-whites; 3) whites have been discriminated against in affirmative action programs that favor non-whites over whites in college admissions, corporate hiring, corporate promotion and government contracting; 4) non-whites are being encouraged,in tax-supported public universities, to hate and want to take revenge on whites; 5) media, licensed by government to use the airwaves in majority white countries, promote race mixing and intermarriage and portray white people as weak and ridiculous on the one hand, or evil on the other; 6) whites who speak out against these things are censored and retaliated against in the military, in public universities, and in corporations holding government contracts. We know that the UN is sympathetic to the plight of the Palestinian people. It might be a good idea to partner with the Palestinians and present a joint case for Palestinian and non-Jewish white dispossession to the UN Human Rights Commission. This would at least put our case on the record, and we might get a positive result as well. .

    • Replies: @Franklin Ryckaert
    , @JUSA
  160. clickkid says:

    Mr Washington was the richest man in town and had the nicest and biggest house.

    He had built his business in his younger years through hard work and inventiveness. In the 196os though, as his household grew and more children arrived, he found that his expenses were continually exceeding his income and he wondered what to do.

    In 1971 he had an idea. Instead of paying for all of his purchases with money he decided to just write IOUs. His credit in town was so good with all of the neighbours and tradesmen, that pretty much all of them accepted Mr Washington’s IOUs, and even used them amongst each other to buy and sell, just as if they were real money.

    This scheme was, as one might imagine, very pleasant indeed, and as the years went on Mr Washington preferred to work less and less, and took to writing more IOUs. His wife was constantly clamouring for new clothes and the kids were always screaming for new toys.
    Eventually, the rumours that had been circulating for some time proved to be true and it emerged that Mr Washington had a machine in his basement for printing IOUs.

    The years passed by and in 2001 a new neighbour – Mr Chang – arrived in town and moved into a small house just across the street from Mr Washington. He proved to be very industrious and after only a couple of years emerged as the businessman in town who was selling the most products to Mr Washington, who was very happy with this, not only because Mr Chang’s products were so cheap, but also because Mr Chang was apparently very happy to accept Mr Washington’s IOUs, produced from the machine in the basement.

    Everybody seemed very pleased with this arrangement until one day in 2013. By this time Mr Chang had more of Mr Washington’s IOUs than anyone else in the town. In fact, he had almost more than he knew what to do with. Mr Chang announced that he would stop accumulating the IOUs and would be getting rid of them straight away in order to invest in his own business – something he called Belt and Road.

    Mr Washington was worried. He noticed that others were following Mr Chang’s lead. He remonstrated with all his friends, cajoling and threatening, to try and stop them getting involved in Mr Chang’s projects. However, they generally ignored him. Everybody was impressed by Mr Chang’s workmanship. In 2014 people started noticing that Mr Chang’s house was bigger than Mr Washington’s. Traders doing business with Mr Chang were also pleased that Mr Chang, although he did sometimes drive a hard bargain, never tried to meddle in their lives, telling them how to bring up their children as Mr Washington did.

    In 2016 Mr Washington started to argue in public wih Mr Chang. He shouted across the street demanding that Chang buy more supplies from him than the other tradesmen. He also claimed loudly that Chang had been stealing ideas for new machines from him. People were puzzled by this because they had never seen Mr Washington with the quantum computers and high-speed trains that Mr Chang had. It was noticed too that the Chang children were doing much better at school than the Washington kids – indeed in math they were four grades ahead.

    The two men continued to shout at each other for months, but didn’t seem to be getting nearer to any kind of agreement. Things seemed to be getting desperate in the Washington household. Mrs Washington could now never afford the newest fashions and many of the kids would go barefoot in the street. The house gradually took on a down-at-heel look. Sometime in 2019 a couple more machines arrived for the basement so that more IOUs could be printed.

    It was at this time that stories started appearing about Mr Chang in the newspapers – long owned by Mr Washingon. These claimed that Chang beat his wife every evening and that he kept some of his children in a concentration camp. These stories didn’t seem to have much effect however. Even Mr Washington’s oldest friend Mr Johnson decided to buy his new advanced telephone from Mr Chang.

    Mr Washington had long had a gang of sidekicks who roughed up anyone who looked like he would refuse Washington’s IOUs, but Chang had grown too big and well-protected to be cowed by them. However, one of these sidekicks, a Mr Turk, went on Twitter in 2019 and blabbered that he had info that Mr Washington was really pissed off and was going to poison the well where the Chang family drew their water. A few months later in October a group of Mr Washington’s paramilitaries, that he employed, were spotted milling around near the Wuhan Well from where the Changs fetched their water every day, but nobody really thought anything of these events at the time.

    Then it happened. It was a tradition in late Winter that members of the Chang family from all over the country came together to celebrate. They had all just arrived and they had all just raised their glasses of traditional spirit, to which they added water. Each Chang drained the glass in front of him in one movement. The whole thing could hardly have happened at a worse time.

    It didn’t take long before the first Changs started getting ill – a few even died. At the present time the healthy members of the family are so busy taking care of the ill Changs that they hardly have any time for business. All the tradespeople are avoiding the Chang house out of superstitious fear and are trying to stop the Changs visiting their houses.

    Mr Washington has publically offered his sympathy for the Changs, but everyone in town has remarked on his smirk. His newspapers are full of commentary alleging lack of hygiene in the Chang household. Some people close to Mr Washington are also spreading rumours that Mr Chang has deliberately poisoned his relatives.

  161. Anon[993] • Disclaimer says:

    This level of evil is beyond Pompeo and Trump I think.
    The Chinese should investigate closely, thoroughly researching all who were in their country during the plausible time period.

    In fact, some of the equipment/luggage the Military athletes brought to the military games could have had small caches of the virus in them _without_ their personal knowledge, and sprung open by remote device. Deep actors in spy organizations that are motivated by fanatic ideologies is where Id guess a guilty party could be found.

    The American people would never be for this cold, only as a return strike. I hope the Chinese know this.

    • Replies: @Anonymous
  162. anonymous[340] • Disclaimer says:
    @Mike P

    So this part of the story can be considered falsified.

    Falsified is too strong. Bedford just doesn’t see anything he would consider unusual.

    The question of that novel protein mentioned in my earlier post remains, however.

    MAYCWRCTSCCFSERFQNHNPQKEMATSTLQGCSLCLQLAVVVCNSLLTPFARCCWP

    You can search for it here

    https://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LINK_LOC=blasthome

    It will tell you “No significant similarity found.”

    So you are not even getting hits for Wuhan coronavirus? Where are getting this sequence from?

    For comparison

    MN908947.3
    https://www.ncbi.nlm.nih.gov/nuccore/MN908947

    MN996527.1
    https://www.ncbi.nlm.nih.gov/nuccore/MN996527.1

    • Replies: @Mike P
  163. George Carlin-Natural Disasters

    • LOL: Alfred
  164. Mike P says:
    @anonymous

    The protein sequence is from the paper I quoted in my initial post. It is from one of the Wuhan virus isolates. The point is that it is not found anywhere else.

    • Replies: @anonymous
  165. Anonymous[694] • Disclaimer says:
    @Anon

    This level of evil is beyond Pompeo and Trump I think.

    Nothing is beyond Pompeo, the man is capable of all kinds of evil. He is a CIA man and a Jew puppet, so basically a Jew. And to a Jew, the end always justifies the means.

    Trump on the other hand, is pretty much a simpleton and easy to manipulate. After a lifetime of doing dirty business with the Jew York rats, the man is simply too easy to blackmail.

  166. Ber says:
    @Almajiri

    “There is no way this is not a declaration of war against China, Russia, Iran and the rest of humanity!”…perhaps if they were to rename it to WARS – or Wuhan Acute Respiratory Syndrome, that would give the game away as warfare against humanity. Cannot afford to do that because it would wake up everyone in the world.

    • Agree: Desert Fox
  167. Erebus says:
    @Mike P

    Thanks for the reality check Mr. P.

    As others have noted, not yet having been observed in the wild can simply mean it has finally, and rather dramatically been observed.

    Discoveries of hitherto unobserved species of (say) beetles in the Amazon delta, or bacteria in volcanic crevices at the ocean bottom do happen from time to time and approx 2 hitherto unseen viruses are discovered annually.

    Nevertheless, that one of those 2 is first observed in humans as opposed to the “wild”, in virulent form, at just the right time, in just the right place to maximize the more desperate of opposing parties geo-political advantage (or minimize disadvantage) begs questions.

    Not yet evidence perhaps, but certainly a signpost on a path worth exploring.

  168. anonymous[340] • Disclaimer says:
    @Mike P

    QHN73810.1 (surface glycoprotein)
    https://www.ncbi.nlm.nih.gov/protein/1800242663

    MN975262.1
    https://www.ncbi.nlm.nih.gov/nuccore/MN975262

    Ok, this is the one you’re talking about. Fwiw, RaTG13 was published on January 23rd, so it wasn’t compared to the Wuhan coronavirus orf3b.

  169. Ber says:
    @Ayatollah Smith

    “Military retaliation? Not too likely. The most appropriate would be a tit-for-tat release of half a dozen pathogens in the US. Also not in the cards. Remaining options: zero.”

    Agree, except when there is a credible threat of taking out personnel responsible for such demonic acts, then things might cool down a bit.

    Of course the problem lies in the identification of such personnel. Nevertheless, if such a message goes out, it will have a chilling effect.

    • Replies: @Commentator Mike
    , @Alfred
  170. Parfois1 says:
    @clickkid

    I still think China wins this game, but at least Washington has delayed inevitable defeat, although perhaps increasing the ultimate severity of that defeat. It has still played geopolitically, although obviously not morally, the least bad move.

    Fully agree. Your step-by-step reasoning has been the bedrock of my assumptions on several comments related to this topic, although expressed in a condensed package, to which I added the proof of precedence, that is, the political elites’ proneness and willingness to use weapons of mass destruction on innocent civilians.

    Consider what is at stake here for those criminal elites: the end of US supremacy and concomitant loss of protection to the Chosen ones. This is an epoch-shattering event.

    Compare with use of weapons of mass destruction during (e.g. Dresden, Hiroshima, Nagasaki) and since WWII (see Denk’s lists above). These crimes against humanity on a grand scale took place when the losing side was already defeated and there was no justification whatsoever other than revenge and evil designs. There were no vital interests at stake whatsoever, yet they did it on spurious and untenable reasons.

    If they were capable of those monstrous crimes, getting rid of a few Chinks to spite them is small fry.

    Any detective looking at it would go through the basic routine:

    Motive, Yes
    Means, Yes
    Opportunity, Yes
    Connection, Yes (a foe).

    All a priori elements are there to point a finger at the main/sole suspect. The evidence may be missing yet for a prosecution in a putative court of law, but in a court of logicians that would be enough, barring the existence of a competing suspect, for a verdict of guilty.

    I’m sure the Chinese virologists will come up eventually with sufficient proof that the novel coronavirus is a synthetic product and its origin. Whether it will become public is a moot point. But that will be enough for Dr Mahathir to convene the Kuala Lumpur War Crimes Commission and indict the criminals.

    • Agree: clickkid
  171. @Ko

    Communism is not the only totalitarianism. Capitalism can also be totalitarian.

  172. clickkid says:
    @Anon

    “Modern China, with its massive and very dense population, and the massive movement of its peoples within its own borders and around the world, was a pandemic just waiting to happen.”
    ——————–

    Yes, waiting to happen…..and its patience to wait any longer ran out just as that biggest migration was getting going for the New Year and right at a time of maximum geopolitical tension, and six months after this was tweeted:

    Which translates as:

    “Decipher: 11.06.2019 The U.S. sent an aircraft of biological weapons to China. Epidemics may begin in China soon.
    They should not forget that if there is a Turk on earth, there is hope.”
    ——————————————

    Those demanding proof will probably only be satisfied when a letter from the Director of the CIA, giving details of the operation, is published on the front page of the New York Times.

    • Replies: @denk
  173. denk says:
    @Pft

    ‘China’s ptb are colluding with our ptb’

    OK you’r against the ptb./elites/oligarchs whatever you wanna call them, so far so good, but….

    I’ve never seen you calling out Washington crimes, your obsession is with the CCP, !

    Dont ditch the US, ditch your own elites’

    See, fukus isnt the problem,
    if only the Chinese would ditch Xi, the Russians ditch Putin, the world would be fine again and everyone would live happily forever and ever. !

    Except the CIA/NED, [[[they]]] would be out of jobs LOL !

    sTILL have doubts ?

    ‘I’d take our delusional democracy over the alternative [Russia/China ] aNy day’

    Clear yet ?
    OUr elites, warts and all, are better than their elites.

    Some ‘anti globalists’,
    what a fucking hypocrite !

    ————————–

    ‘This is a CCP FF for depopulation’

    Lets say there’s a serial arsonist lurking around JOhn’s neighborhood.
    JOhn’s house caught fire last night,
    Who’d be the prime suspect, the ArsonIST who hates John’s gut .!

    But there’r no shortage of perverts like pft who say ‘JOhn did it to claim for insurance’

    murkka is full of sickos like this,
    who always project their own perversion onto OTHERS.

    William Cohen

    OTHERS are engaging in nefarious proj like race specific bioweapon and Ebola etc etc

    Then we had SARS1 in China and Ebola in Africa.

    2012
    Clinton

    There’s the danger of genetic biowarfare from AQ

    then China caught a cold in 2013 !
    [Clinton is a mason insider, wonder if she attended that ANGLO SAXON MISSION brainstorming in 2005 ?]

    Where do you think all these Clintons, Pompass, BOlton, Trump, Pence, Bannon…..come from ?

    There’s a huge pool where [[[they]]] come from.

    What a fucking cunt you’r , pft.

    There’ll be no second revolution.

    QED

  174. annamaria says:
    @Bert

    Why do you avoid a finer-grained assessment of the article, namely, that it serves the well-deserved anti-ZUSA narrative? The ZUSA ‘deciders,’ whatever the color of their skin (Cheney, Wolfowitz, Clintobama) have been working against western civilization. Look at the fate of the EU, this miserable vassal of the ZUSA. https://www.zerohedge.com/geopolitical/italy-salvini-facing-show-trial-kidnapping-migrants

    Also, why do you think Madame Ghislaine Maxwell, the procuress of underage girls for the pleasure of Bill Clinton and the likes, enjoys freedom and keeps her properties in the UK untouched by the sanctimonious UK authorities while Julian Assange, the treasure of humanity, has been rotting in a high-security prison on the territory of the UK? https://consortiumnews.com/2020/02/10/julian-assange-wins-2020-gary-webb-freedom-of-the-press-award/

  175. @Just passing through

    So you are saying you are uncivilized?

  176. nsa says:
    @eah

    “…is there a naturally occurring affliction known to only affect Asians / Chinese?”

    There certainly is! What about severe chronic SDS which mostly affects East Asians ……..the very debilitating Short Dick Syndrome? Could SDS also be induced by a widespread CoV virus that only affects the DNA of East Asians in utero? Would it be possible to end the horrible SDS scourge by locating the afflicted gene in Asian DNA strands and then say gene splicing in another similar genetic component….say one from Africa? This does present somewhat of a conundrum, which ran by the very famous Beijing University Professor Emeritus, Ty Nee Wang. He thinks male Asians would love to have 10″ but wouldn’t like it if it were a black color. He also thinks female Asians would accept any size or color as long as it is attached to a male with a good job and lots of savings to spend.

  177. Erebus says:
    @clickkid

    Great post.

    I consider that an attack with biological weapons causing immense economic damage, but with plausible deniability was quite possibly the best remaining move on the geopolitical chessboard for Washington.

    With all power trend lines on a downward slope, and abrupt end stops now visible on the most important of them (principally, financial), the time has come for a last minute Hail Mary pass.

    The question is if the American pigeon has landed on the geo-political chessboard. If so, from landing the Eagle to landing the Pigeon, we’ve come round to the endgame at last.

    • Thanks: clickkid
  178. @Robert Dolan

    The UN itself is part of the White Genocide Conspiracy. It has even a “replacement migration” plan for the ageing populations of all White countries (and Japan and South Korea). Here is what the UN itself says :

    “…United Nations projections indicate that over the next 50 years, the populations of virtually all countries of Europe as well as Japan will face population decline and population ageing. The new challenges of declining and ageing populations will require comprehensive reassessments of many established policies and programmes, including those relating to international migration.

    Focusing on these two striking and critical population trends, the report considers replacement migration for eight low-fertility countries (France, Germany, Italy, Japan, Republic of Korea, Russian Federation, United Kingdom and United States) and two regions (Europe and the European Union). Replacement migration refers to the international migration that a country would need to offset population decline and population ageing resulting from low fertility and mortality rates…”

    Source : Replacement Migration – United Nations Population Division…

  179. denk says:
    @clickkid

    You’r one of the few who gets it.

    But your claim that CCP might be inflating the casualties figure is off base.

    cuz that’d be playing right into the hand of fukus, [[[they]]] have been trying their damndest to play up the fear porn, to force a WHO declaration of global pandemic crisis,, which’d mandate a total quarantine for China,.

    game, set , match for the [[[sobs]]]

    • Replies: @clickkid
  180. Naill says:

    Thank you Metallicman!

    You have certainly created a comprehensive picture linking the single incidents into a very plausible scenario as one does with a jigsaw puzzle where each piece gives more clarity.

    There has been certainly a lot of noise both real and fake over the past month. As we know, liars tend to make a lot of noise in order to distract and prevent the truth from being found. By separating the relevant facts from the irrelevant details and presenting them here you have given us much food for thought.

  181. JUSA says:
    @clickkid

    Good story.

    Not sure how Mr. Turk fits into the story.

    Hopefully all of Mr. Chang’s relatives are smart enough to know who poisoned the well.

    • Replies: @clickkid
  182. @Just passing through

    That what I have said and thought before. The China “fast speed building time” hospital is just another ‘act big talk big’ that can impress only people who don’t have any knowledge on the prefabricated or field building, inferior complex, especially the pro-China (some of them is toxic Sinophilia). To be honest, I’m nearly get tricked by this but successfully avoid being ‘brainwashed’ by China ‘act big talk big’ after spending many times to research and investigate (because search engine always put the ‘fast speed hospital building’ first and my knowledge is very limited with bad English so it take me more time to find the information). I talk about this in my last comment:

    https://www.unz.com/article/how-to-yellow-cake-a-tragedy/#comment-3711804

  183. @clickkid

    Add to this story the fact that “Mr Washington” has a history of criminal behavior towards every neighbor who refused to follow his orders, and his guilt seems all the more likely.

  184. Parfois1 says:
    @clickkid

    Some people close to Mr Washington are also spreading rumours that Mr Chang has deliberately poisoned his relatives.

    A very clever parable by the creative ‘Kid. And a good laugh too.

    Can you imagine an amusing sequel? I’ve heard a rumour on the bush telegraph that Mr. Chang has been making up with Mr. Ivanovich (who makes very modern toys and fireworks) and both are plotting to build a tunnel leading to Mr. Washington’s house and store under it the fireworks…

  185. @Alfred

    It is amusing to see how some people manage to see some good in this disaster –

    Well, far be it from me to mention that reputed humanoid Mark Zuckerberg married a Chinese woman and fathered a child with her. Maybe he can use his many billions of ill-gotten gain to fund a vaccine.

  186. annamaria says:
    @Hail

    “his mixed-race children were born, presumably in China…”
    — One can only imagine how suspicious you should be towards dual-citizens in the US government and the ziocon stink-tanks that influence the ZUSA policies. See Iraq, Libya, Syria, Ukraine…
    Do you really believe in the high moral principles of the ZUSA’s deciders?
    “The Pentagon Bio-weapon:” http://armswatch.com/the-pentagon-bio-weapons/

    Chinese biological material has been collected under a series of federal projects including saliva and cancer tissue. Among them, Genotyping DNA Samples from Lymphoma cases and from controls (healthy patients), Breast cancer tissue blocks from breast cancer patients, Saliva samples of 50 families who have 3 or more cases of UGI cancer, Genotype 50 SNP’S for DNA samples from the Cancer Hospital, Beijing, Genotypes from 3000 cases of gastric cancer and 3000 controls (healthy patients) in Beijing. …

    Article 8 of The Rome Statute of The International Criminal Court (ICC) defines biological experiments as war crimes. The US, however, is not a state party to the international treaty, and cannot be held accountable for its war crimes.

    More: “Israel is Developing ‘Ethnic Bomb’ for Growing Biological Weapons Arsenal” http://www.ihr.org/jhr/v17/v17n6p24_Weber.html
    Israel is not a signatory to the Biological Weapons Convention (BWC):

    It is assumed that the Israel Institute for Biological Research in Ness Ziona develops vaccines and antidotes for chemical and biological warfare

    https://en.wikipedia.org/wiki/Israel_and_weapons_of_mass_destruction

  187. aandrews says:

    Personally, I think it’s karma for barbecuing dogs alive.

    • Thanks: TKK
    • Replies: @TKK
  188. Naill says:
    @Ko

    “I’ve had 43 Chinese students over the current and past semesters. Most of them hate their government.”

    Unlucky you! I have had 14 years of meeting chinese students and adults and have never heard that they hate their government. If anything, they usually speak in support of their government and this while outside of china too with no cameras or anyone else one else within earshot

    • Replies: @Ko
  189. JUSA says:
    @Robert Dolan

    They have also successfully turned white women against white men.

    The large scale importation of Indian code coolies is to replace white men, who are still the best software/hardware engineers. Indians are almost as dark as blacks but a shade brighter between the ears, are good boot lickers and much easier to manipulate than whites. Chinese are too smart therefore need to be killed off by coronavirus.

    Once discrimination against white men is widespread, they will start identify as Jews, talk up Jewish oppression and Jewish pride, and insert themselves at the head of the protected groups.

  190. @Anonymous

    “It’s totally irresponsible to state what the author is stating, and not supported by the facts, beyond circumstantial connections.”

    Thanks.

  191. Derer says:

    This dangerous game is turning into an arena of conspiracy theories – wrong direction. I hope this is only plausible supposition, but USA is capable of this sinister vindictiveness. CIA needs new pastime. However in due time Chinese scientists are capable of resolving this issue and they do not lie. When funeral homes in the US will become very busy, only then we will know what Chinese scientists and military found out. Welcome to retaliation mayhem.

  192. anon[109] • Disclaimer says:

    Personally, I think it’s karma for barbecuing dogs alive

    Yes it is karma. the ching chongs are a horribly cruel and barbaric people.
    They eat chicken lips and tiger dicks, and put whole bats in their asses.
    They’re getting sick because everything they do is against natural law and God.

    • Troll: d dan, Herald
    • Replies: @Franklin Ryckaert
  193. TKK says:

    The HIV virus, that rapidly mutates into AIDS, is a zoonotic disease. This occurred when an African in Sub Sahara ate chimpanzee or some higher primate.

    The infamous Patient Zero, a homosexual Belgian flight steward, was found to be flying around the world having anal sex with thousands of men, heavily in bath houses. Ground Zero of the virus starts with the consumption of bush meat, and took flight through homosexual male sodomy. Patient Zero had so many partners he could not assist researchers in winnowing down the list to African partners or men who had sex with Africans.

    The Wet Markets in China have freshly slaughtered exotics ready to be consumed that are butchered primitive . Most serious researchers believe this virus, like SARS, is zoonotic.

    It’s more tin foil hat fun to blame a cadre of Boltons cronies- but how about good old personal responsibility?

    Bacteria and viruses are the biggest, baddest killers on the planet. No conspiracies needed.

  194. TKK says:
    @aandrews

    The photos of Chinese police beating stray dogs to death because they assumed they had the virus is another bullet point to add to the Chinese’s repellent treatment of mammals.

    • Replies: @Alfred
  195. Anon[234] • Disclaimer says:

    A point that needs to be made is that Eastern China’s godawful air pollution doesn’t just cause more respiratory disease in humans, it does the same thing for animals. Pigs, chickens–and bats. They all have to breathe the same polluted air. We have had a whole string of respiratory disease outbreaks from these animals over the last 20 years in China–these populations have had terrible viral outbreaks for many years now–and COV19 certainly isn’t the only one of them that’s new to medicine, either.

    COV19 is supposedly a bat virus. If Eastern China’s bat population is sickly from the bad air and carrying a higher-than average load of respiratory viruses, this would speed up the mutation rate of those viruses. All it take is one virus that can infect both bats and humans, and some dumb Chinese person who eats that bat, and we’ve got COV19.

    We got HIV because of some dumb African likely having sex with a monkey. COV19 was likely a mutation caught from a bat-eating idiot.

    • Replies: @Stonehands
  196. Hohot says:

    Here are my two theories. It could be either or both: 1) The Chinese were designing a bioweapon with the intent of vaccinating all their citizens first, then turning it loose on everyone else. Someone screwed up and it accidentally got out. **Suppose they did that…why? They own the paper on loans with Belt and Road. If nations can’t pay, they can repossess hard assets. If you depopulate first, there is no opposition to stop them like those annoying folks with the annexation of Tibet. Besides then you can give the USA, Russia, and Europe the finger while they buy your vaccine. 2) The Globalists are so desperate to end Trump, since nothing else has worked, “we’ll sacrifice the Golden Goose to sabotage the election. ” Trump’s platform is the economy, so wipe it out by cutting the head off the supply chain. Create shortages of things like drugs while driving up prices. (97% all antibiotics sold in US from China. https://www.cfr.org/blog/us-dependence-pharmaceutical-products-china)

    You write that you’re speculating…then why don’t you include an opposing view? Everything is slanted towards blaming the USA…why? You negate the fact that the Chinese are long term players for the end game. The Middle Kingdom openly tells you that they are the oldest civilization and they OWN THE WORLD. Did you miss their invasion into the South China Sea? They have no moral limits and are xenophobes so they lie continuously. Example: China has been rigging their data as mathematicians and statisticians have proven that their reported cases, etc. followed a specific formula with a death rate of 3% which got lowered to 2.6%. https://www.zerohedge.com/health/how-china-rigging-number-coronavirus-infections

    China is Google’s and B. Gates’ wet dream as it’s total surveillance, a cashless society, no private ownership of land, and everyone concentrated in easily controlled metropolises. Remember Google is behind their Social Credit Score (See BlackMirror’s Nosedive.) Trump already hurt them economically; a bioweapon is unnecessary and actually counter-productive.

    Are you a Chinese apologist? “Except China is Communist in Name only, just like America is a Republic in name only.” Are you implying they’re capitalists within a republic? Have you lived there or know anyone who does now? The government RUNS/OWNS EVERYTHING. You’re not allowed to pick up limbs from a dead tree to burn to keep from freezing to death as it belongs to the government. Motorcycles and pick up trucks are not allowed as they can promote freedom of movement. Every college has a CCP police force and jail on site. Want to see the man on the street experience? Go to the YT videos of Laowhy86 and serpentza. An American and a South African man who lived in China 10 years, married C wives, and had to leave.

    Sprinkled with truth but full of lies.
    Although you have strung together some verifiable misdeeds by the Deep State and facts regarding the virus and labs, your statements about how the Wuhan Lab is just diagnostic is laughable. Your theories are 1) It’s a bioweapon: agreed as the genome reveals this through 60% SARS with some bat and other DNA thrown in. It seems to deplete selenium rapidly.(See below) China is a selenium poor country. Pork is a source of selenium. 2) It’s highly contagious and SE Asian males are more susceptible: agreed. It has to do with specific lung receptors and the habit of smoking. Most Chinese males smoke. 3) Virus is not bad for Caucasians: wrong. Although preferential to Asians, it can and does infect all ages and all races as seen by the diversity of patients outside China. The true mortality is unknown as we do not have enough data. 4) The meanie legit American government did it: wrong. There’s no long term gains as our manufacturing can’t gear up fast enough to replace them. 5) American people visiting Wuhan before the outbreak did it unlikely. Gee, could it be they went there because of the Winnipeg virus thefts? It’s very difficult to infect others without contaminating yourself if it’s airborne. The only way would be a detonated device once you’ve left the scene, and that means obtaining the virus, and making a bomb under the Chinese noses. Unlikely. 6) Chinese gangsters spreading swine flu with drone: could be. Their desire to be rich is so all consuming, they would never consider bad consequences outside their desired goals.

    Regarding the “poor framed Chinese scientists” expelled from Winnipeg in July 2019: 2/8 Frank Plummer 67yo, the Canadian who was a director at the lab and was key to the espionage case died Feb.5 while at a conference in Kenya under mysterious circumstances. https://www.zerohedge.com/geopolitical/canadian-scientist-center-chinese-bio-espionage-probe-found-dead-africa.

    Wuhan scientist Dr. Peng has been working with SARS and bat viruses for years. Bats have the ability to transmit diseases without getting sick themselves like ticks.
    After more than 10 years of research, Zhou Peng discovered that an antiviral immune channel called “interferon gene-stimulating protein-interferon” in the bat’s body was inhibited, so that the bat could just resist the disease without triggering a strong immune response. The results were published in Cells, Hosts and Microorganisms, which aroused the attention of the academic community.”

    Dr. Peng had been hiring unqualified post-grads to work in the lab in October.
    https://www.zerohedge.com/health/man-behind-global-coronavirus-pandemic

    Chinese file for vaccine patent January 20, 2020.
    https://www.bloomberg.com/news/articles/2020-02-05/china-is-trying-to-patent-gilead-s-experimental-coronavirus-drug

    Vaccine – Not so soon! When they tried a SARS vaccine on animals, then exposed them to SARS, all the animals had an overblown immune reaction causing deadly lung destruction. Thought to induce cytokine storm.

    Go to 14:10 Did you know Spanish Flu was deadlier the second wave as a mild case predisposes you to reinfection? A victim was unearthed and genome sequenced by NIH in 2007. https://www.sciencedaily.com/releases/2007/07/070702145610.htm

    Wonder why WHO has been slow to respond? WHO head is an Ethiopian politician. Ethiopia is the largest recipient of China’s Belt and Road Project in all of Africa. So far Ethiopian Airlines continues to have direct flights from China while everyone else stopped. “Tedros Adhanom Ghebreyesus is an Ethiopian politician, academic, and public-health authority who has been Director-General of the World Health Organization since 2017. He served in the Government of Ethiopia as Minister of Health from 2005 to 2012 and as Minister of Foreign Affairs from 2012 to 2016.” Wikipedia

    Event 201- sponsored by B and M Gates, Johns Hopkins and Bloomberg ran a suspiciously similar simulation in Oct. 2019. Their conclusions? Anyone who writes/says anything different fromWHO should be jailed. (China is adhering to that.) 2) If the virus is uncontainable, only care about stopping social unrest and the economy.

    SARS, AIDS, Black Plague, Spanish Flu, Airborne Anthrax, etc. all cause hemorrhaging and severe pnuemonias/cardiac failure through the CCR5 receptor on the macrophage (White blood cell.) They hijack the immune system and deplete selenium. Dr. Hou treated Zaire Ebola patients in the 90’s with oral selenium and dramatically dropped the death rate. http://drpasswater.com/nutrition_library/selenium_aids.html This depletion affects the ACE2 enzyme. If given free reign, it will do a rogue immune response and causes something called a cytokine storm. It brings on rapid heart failure.

    Those with European ancestors are more likely to have at least one copy of the Delta32-CCR5 mutation as individuals with double copies (some singles) survived the waves of Bubonic Plague. In tests, Asian and Middle Easterners have 0-4% incidence. This makes those groups more susceptible to death from certain diseases. https://en.wikipedia.org/wiki/CCR5. https://www.sciencedaily.com/releases/2005/03/050325234239.htm

    Spanish Flu – typhoid vaccine was used in 1915 with triple vaccine later. https://www.thelancet.com/pdfs/journals/lancet/PIIS0140-6736(14)61786-4.pdf

    I think this is a likely cock-up that got loose pre-vaccine. We’re all going to suffer one way or another because of it. Welcome to Globalism.

  197. Anon[234] • Disclaimer says:
    @Al Liguori

    If Jews think they can wipe out Arabs with a disease that leaves Jews alone, they’re kidding themselves. A lot of Jews share a very close genetic kinship with Arabs. Besides, anyone in bioscience knows your virus can mutate and just kill everybody.

  198. Anonymous[257] • Disclaimer says:
    @Ayatollah Smith

    May I ask a question? When were the floors, exterior and interior walls , roof with all necessary HVAC, water, power, water and sewage lines already installed manufactured? How long did it take? What about all the easy to clean the tile and vinyl that covers every hospital surface? What about clean up of all the construction dust and grime?

    Were the fabricated sections sitting in a warehouse somewhere waiting for an emergency? Must have. It would be a good idea in China with its periodic epidemics. Something a sensible government does. China probably has something like FEMA or national guard medical units.

    China always has epidemics. Before planes and ships and even mule and camel trains to Europe and India migratory birds who wintered in S China carried the diseases world wide.

    It’s a stretch to think tens of thousands will die.
    It’s a stretch to think it’s bio warfare. China has a new epidemic periodically. The government and people scramble to contain it. It soon ends.

    It’s like earthquakes in California or Japan and hurricanes in the Caribbean and Atlantic coast of America. Dense concentration of people and farm animals create the new diseases and long before planes ships and camel trains migratory birds spread the disease and still do.

    If Trump, Zionists and the Deep State want to harm China I can think of a far easier way.

    Just raise tariffs, plus docking, unloading, utility hook ups and other Harbor fees.

    • Replies: @Neutrino
  199. Anonymous[257] • Disclaimer says:
    @mr meener

    The contractors who build hospitals sign contracts with the hospitals and every entity that contracts with them to build something.

    There’s always a completion section. Complete the building on time, on a specific date. That date is the date the local building fire and health inspectors issue the occupancy permit.

    If the building isn’t completed by that date the contractor pays a heavy daily fine until the building is completed. All the sub contractors sign similar agreements with the general contractor. Why would union workers purposely delay the job? As soon as one job’s finished there’s another one.

    There’s no delays in commercial industrial construction. Builders can’t afford to pay the horrendous daily fines.

    Most clients customers have on site inspectors walking around the site daily. Those client inspectors are there to see the contractors and workers don’t just “ slam it through” as it’s called. On site client’s inspectors have become very common. They’re there to see the work is carefully and expertly done, not just slammed through. The clients for whom those buildings are constructed wouldn’t pay for on site inspectors if they weren’t necessary.

  200. @Delta G

    wow you’re a total fucking imbecile

    i suppose the brits didn’t give the native americans blankets soaked with diseases in your fake little world

    • Replies: @denk
    , @Anonymous
  201. @Ber

    Yes, targetted assassinations are an option, including of scientists who developed this virus. The media would then explain them away as accidental or natural deaths, or suicides.

  202. Very well researched article. I had collected much similar information on my personal thesis and some of your research coincided with mine. I ask you also look into “Army Worms” in China as well and the new H5N1 avian flu designed to target chicken stock.
    Army worms have mysteriously appeared in China to decimate crops and chinese agriculture some of them targeted crops specifically in the trade war.
    Much more will be revealed if you study how americans did to cuba. Look into the JFK files about cuba and sugar plantation etc.
    How evil, seriously. But can’t count anyone out that actually used nuclear weapons on innocent civilians and what they did to the natives of Marshall Islands.

    • Replies: @denk
  203. @AB_Anonymous

    It’s not immune to conspiracy, and the article certainly raises eyebrows, but why design a virus that kills old people and not children?

    One complaint vs many circumbstantial clues though. Thinking it over though, there sure are too many coincidences!

    • Replies: @clickkid
  204. Anonymous[422] • Disclaimer says:
    @Lot

    Yup. He’s a confirmed nutcase. His tl;dr article is still a good nucleation point for our comments though.

  205. @Just passing through

    ”…more civilisation means more rules = less freedom.”

    Finally, someone gets it!

  206. Alfred says:
    @Mike P

    PCR is far cheaper, simpler, and more versatile than the high-tech stuff that you describe

    PCR = Reverse transcription polymerase chain reaction (Jewpedia)

    “Poly” means in Greek “many, much, very”

    Before anything is done, the RNA must be converted to DNA.

    Here is a description of one of these cycles. The sample must be repeatedly heated and left for some time before being cooled again. Check my reference for more details.

    Steps Involved in Polymerase Chain Reaction in DNA Sequence

    1- Initialization
    2- Denaturation
    3- Annealing
    4- Extension/elongation
    5- Final elongation
    6- Final hold

    Some of these steps are complex. They all take time, skill, care and effort. It is easy to contaminate the sample and to thereby get false positives.

    The techniques with nano materials and electricity are almost instantaneous and there are no heating/cooling cycles. It is direct. There is no amplification.

    How on earth can PCR be better for separating a group of people (say on a ship or building) between those who are infected and those who are not infected?

    You are comparing chopping down a tree to make a fire with turning on a light switch.

    • Replies: @Mike P
  207. Anonymous[298] • Disclaimer says:
    @Delta G

    This article reminds me of the articles about 9/11 truth that would include some useful stuff but then poison-the-well garbage positing that a “micro-nuke” was used, or that a glint of light was a missile coming from one of the jets. The sort of stuff that makes conspiracy theorizing look bad. Source is either US govt (CIA?) or JIDF.

    There is a new cold war between the US and China. China is building island bases, and upgrading energy/resource security. It may be foolish of China to poke the bear. They were doing well in peace mode.

    So now the US will make war with China using means that will not involve nukes. This means war of economics and resource (energy, maybe other strategic stuff like rubber was in WW2) starvation, cyber war or even proxy hot war.

    This virus does seem like the sort of economic caltrops likely to screw them over for a year or so. Every business is now looking to find backup sources of production away from China, so this will have some longer impacts. However there would be no ability to link it back to the USA. It would all be plausibly deniable. Down to being released near China’s own virology facility, if this was the case.

    I think we will never know what the source was. Careless leak of SARS prototype in the Wuhan lab, genuine virus crossing into the human population from other species, or US bioweapon released in a convenient location. China will spin it as a US attack to save face, as the other options involve loss of face. Entertaining to think about.

  208. @Hail

    Metallicman also claims to have a permanent device implanted in his brain from his MAJestic years that allowed government surveillance of his memories of exploration of alternative collapsed wave universes.

    Casual perusal of his website reveals approximately 6 billion words spread out over various conspiracy type topics. His expertise “ rocket science” is the most relevant regarding TOE and reconciliation of general relativity and quantum mechanics- moving beyond Newtonian explanations of the nature of reality- towards subjective idealism/ imaginary numbers paradox solutions.

  209. @Parfois1

    It is difficult to believe that there are people so evil in the upper reaches of the JewSA that they would deliberately release a toxin that would murder millions. I certainly don’ t want to believe it.

    But we live in a world where the US is controlled by folks who orchestrated the spectacular 911 false- flag attack. An attack whose purpose was to start a series of endless wars in the ME for the benefit of Israel. As well as to create a security state where all our liberties must be rescinded to fight these terrorists.

    Therefore, anything seems possible. Including that elements in the JewSA’s government deliberately releasing this virus in China. I sure as hell hope not.

    But if it turns out to be a man-made virus then I would think it was likely a deliberate release. And if that is the case you can bet the Chinese know it.

    This is the problem when you have traitors running your government; they don’t give a shit about the average citizen. If millions of innocent people need to die, including Americans to keep the criminal enterprise going, then so be it.

  210. Alfred says:
    @Hail

    Attempting to demolish the argument and observations of the writer by attacking his lifestyle, location, family and so on is an old favourite.

    Implying that there is something wrong with marrying a much younger woman is amusing. I never go out with a woman who is less than 30 years younger than me. 🙂

    Nature has made men fertile into old age and it is ridiculous to try and impose your feminist values on others. If you wish to do like prince Charles, that is your choice. I will never criticize you even though I may find it amusing.

    How are we supposed to trust more the opinions of shills on the NYT who only ever travel abroad when they get a freebie from their Zionist masters? People who cannot speak foreign languages and who have never spent a night with an exotic lady?

  211. anon[167] • Disclaimer says:

    https://www.nature.com/articles/d41586-017-07766-9

    To clinch the case, a team led by Shi Zheng-Li and Cui Jie of the Wuhan Institute of Virology in China sampled thousands of horseshoe bats in locations across the country3. “The most challenging work is to locate the caves, which usually are in remote areas,” says Cui. After finding a particular cave in Yunnan, southwestern China, in which the strains of coronavirus looked similar to human versions4,5, the researchers spent five years monitoring the bats that lived there, collecting fresh guano and taking anal swabs1.

    Researchers at the Wuhan BSL-4 lab were collecting and studying bat coronavirus strains as recently as 2017.

    What’s more likely, that the US escalated a trade war (which China started through its protectionist policies and economic espionage) to a biological war, or that the nation famous for its gutter oil and overall poor sanitation can’t study highly dangerous, easily transmitted pathogens without them getting loose?

    The fact that Chinese social media is latching onto this conspiracy theory instead of blaming the CCP for its incompetence saps me of what little sympathy I had for these people to begin with:
    https://www.independent.co.uk/news/world/asia/yulin-dog-meat-festival-video-china-blow-torch-animal-cruelty-a8969361.html

    Hopefully the Japanese, South Koreans, and Taiwanese aren’t as affected by nCoV, despite their genetic affinity with mainlanders.

  212. clickkid says:
    @denk

    Thanks!

    Regarding possible inflation of the figures:

    I have played with that idea. My assessments of its probability go up and down. Obviously it’s a very unclear situation. At the moment it is not an argument that I would make

  213. clickkid says:
    @Ilya G Poimandres

    “but why design a virus that kills old people and not children?”

    It isn’t the killing as such that counts – it’s the massive economic cost that is important.

  214. clickkid says:
    @JUSA

    Thanks!

    As for ‘Mr Turk’, I was referring to this- retweeted a couple of times in the past few weeks.

    Tweeted on 11th June 2019 by a Turkish nationalist with connections to his country’s military:

    Translation:

    “The U.S. sent an aircraft of biological weapons to China. Epidemics may begin in China soon.

    They should not forget that if there is a Turk on earth, there is hope.”

    ReplyAgree/Disagree/Etc. This Commenter

  215. Sam J. says:

    “…No nation would be so crazy, so stupid, so insane, so evil… as to launch a very deadly WMD inside a nuclear-armed world power on their most important holiday. Right?

    Who would be interested in doing this?…”

    The Jews.

    “…The calls for drastic and immediate action against China are all over the major American neocon publications. Just because you (personally) are not aware of them, does not mean that they do not exist. These neocons are foaming at the mouth for a fight…”

    The Jews will fight down to the last American.

    As the article mentions this virus does point towards the US. So much so that I can not even remotely believe that the US would do this, but the Jews would.

    Have you people not forgotten the severe tension before the elections? It appeared to me that there was a Jew run up to a Russia/China vs. USA nuclear war. I said before the elections that I thought they were going for a war to knock out all their enemies and stop the widening of understanding of just how evil the Jews are and have been. While US, China, Europe and Russia were burning in flames and baking in radiation the Jews would nuke and use biological warfare on the Arabs and Persians. I expected this to be a sure thing if Hillary won. Why? The Jews are in trouble. Lots and lots and lots of people are finding out the long and sordid murderous past, and present, of the Jews. 9-11 had a building, #7, fall as if only air was holding it up it fell so fast. People are beginning to notice this and if I, some regular guy, can see this how can the Jews who run ALL the major media not see the same thing I and many others can?

    The Chinese have rebuffed the standard Jew playbook of having a few super rich Jews move in and take over the banks and press. The Chinese are not having it and they are the next big thing. Normally the Jews would start moving to the next big thing and propagandizing it for their parasitical habitation but this time it’s not working.

    I don’t know how much or if all Trump is controlled by the Jews but it looks like he is in no way pushing WWIII like Hillary was. So…plan “B”. The Jews commit biological warfare on the Chinese and blame it on the Americans. How convenient.

    It’s just not possible the US did this. It’s too risky for too little gain but for the Jews knocking out China is vital. The Chinese will never let the psychopathic Jews enslave them and the Russians having flung off the Oligarchic Jews are not in any hurry to have them back. The Chinese remember whose opium it was smuggled into China. Hint[Sassoon].

    People make the mistake of assuming the Jews are people like them with the same sort of emotions, wants, needs and morality. I don’t believe this. I believe there’s a name for people who act in the manner that they do and this would explain their reasoning, behavior and mental capability to commit mass genocide with germ warfare. It’s very strictly defined and on a mental health chart you could check off the symptoms one by one and get a complete diagnosis in minutes.. It’s psychopathic. There’s one idea that describes the Jews perfectly. It describes their parasitism, their, lying, their chameleon like behavior, their sense of superiority and belief that they are different from everyone else. There’s a simple explanation for why the Jews are hated so much that also explains their behavior and success. The Jews are a tribe of psychopaths. Not all, maybe not even the majority, but a large number. All of the Jews ancient writings are nothing more than a manual for psychopaths to live by. The Talmud is nothing but one psychopathic thought after another. The Talmud “great enlightenment” basically says that everyone not Jewish is there to serve Jews. All their property is really the Jews. No one is really human unless they’re Jews and their lives don’t matter. A psychopathic religion for a psychopathic people.

    They’ve been thrown out of every single country that they’ve been to in any numbers. Psychopaths having no empathy themselves can only go by the feedback they get from the people they are exploiting. So they push and push to see what they can get away with. The normal people build up resentment towards them. Thinking “surely they will reform or repent” like a normal person who does wrong. Of course the Jews do not. They don’t have the mental process for reform. Then in a huge mass outpouring of hate for the Jews, fed up with the refusal to reform their behavior, they attack and/or deport them. In this stage of the cycle the Big/Rich Jews escape and the little Jews are attacked.

    Start over.

    Even if it’s wrong if you assume the Jews are a tribe of psychopaths you will never be surprised and Jew’s behavior will make sense.

    The upshot of all this is we MUST get rid of the Jews. They are threatening our very existence. They’re going to get us all killed. They must go. Peacefully if we can get it but by any means necessary they must go no matter what the consequences.

    • Replies: @Franklin Ryckaert
  216. denk says:
    @truthseekerULT

    Exactly what I thought.

    swine flu, bird flu, army worms depleting livestock and food crops.
    Must be just another coincidence eh ?

    What happen if the locust cross over from India ?

    • Replies: @Ber
  217. Mark R says: • Website

    I read a few days ago, this may be retribution against China for it’s role in the opioid epidemic we have here. China manufacturers up to 85% of all our drugs. I work in the field of alternative medicine and have access to traditional Chinese herbal medicine. I will not use it, as much of what comes out of China, even the medicinal herbs, is tainted. One never knows what one is getting.

    We know China sends fentynol to Mexico, and they in turn use the cartel and smugglers to carry it over the border to the US. So is it any wonder, there may be those in high places who decided this? I do not know nor can I speculate, however, if you want to hurt your enemy this would be one way to do so. The world market(s) are reeling from it’s affect.

    On a different note, here are a few proven ways to combat any virus:
    Highly concentrated plant-based proteolytic (protein-loving) enzymes destroy all micro-organisms. Viruses have a protein “coating” which proteolytic enzymes “attack” and destroy on contact.

    Nano-particle (better than colloidal) silver destroys micro-organisms on contact. It acts quickly and together with enzymes there is no chance of any micro-organism to develop resistance or tolerance.

    Increasing oxygen in the blood (do NOT use hydrogen peroxide). “C e ll F ood” is one such liquid capable of doing so. Hydrogen peroxide destroys healthy cells in the process of destroying other micro-organisms. I worked as a med tech where we used ozone therapy to treat cancer and HIV successfully. While it is obvious NOT to breath in O3, using it in other ways destroys all micro-organisms. There may be doctors in your area using this therapy.

    Licorice root (do not use in hypertension) is known to destroy SARS by preventing replication. Other botanicals are available that can do the same. The fermented dish of Korean Kim Chi was proven to be deadly to SARS as it is the bacterium that proved fatal for it.
    There are many other documented possibilities in the alternative medicine world, one just needs to research a bit.

    • LOL: ploni almoni
  218. Alfred says:
    @TKK

    The photos of Chinese police beating stray dogs to death because they assumed they had the virus is another bullet point to add to the Chinese’s repellent treatment of mammals

    I agree completely. Dogs are more important than Chinese people. Dogs should be allowed to spread any biological poison that the USA drops on China.

    We should bring back that old sign “No Dogs and Chinese allowed” and put it at the entrances to our parks.

    • Replies: @denk
    , @TKK
  219. denk says:
    @wow that was stupid

    Re the tainted blankets given to Native Americans.

    It sounds controversial with quite a lot of people challenging the claim.

    But with 20/20 hindsight, having witnessed the kind of shit UKUS been crapping on the world for these past seven decades.
    Im now convinced [[[they]]] did use biowarfare on the native Americans.

  220. denk says:
    @Alfred

    OTOH,
    Have you noticed the CIA film studio has been working overtime lately. 😉

  221. Some say that the emergence of the epidemic in Wuhan indicates that it probably is due to a leak from a laboratory there.

    An alternative explanation is that if this is bio-warfare, it is a a clever move to start it in Wuhan, since one may then say with some credibility that the Chinese at that laboratory are probably to blame.

  222. Mike P says:
    @Alfred

    Steps Involved in Polymerase Chain Reaction in DNA Sequence

    1- Initialization
    2- Denaturation
    3- Annealing

    After the reaction is set up by mixing sample material, buffer, nucleotides, and enzyme, all those steps which you enumerate involve nothing more than just temperature up- and down-shifts. These are simply programmed into a machine. Such machines have been available for decades; you can buy a simple one for less than 10,000 bucks, although those that also optically monitor the amplification of DNA over time will cost more.

    The microfluidic device that you describe is simple in principle, but it will be much trickier than PCR to use and reuse in practice. It is just another high-tech solution in search of a problem. There are lots of those things being developed by people doing “microfluidics” and “nanotechnology” – for lack of better ideas, they propose to solve problems that have already been solved. A popular one is DNA sequencing by pulling DNA molecules through nanopores and measuring fluctuations in electrical resistance as each successive base passes the bottleneck. This idea has been around for decades; it is still being “improved” but still doesn’t work, while real PCR-based sequencing has progressed by leaps and bounds.

    Another one, a real howler, which I encountered recently, was the proposed use of microfluidics for – wait for it – wastewater treatment. I challenged the presenter, commenting that I could not think of two “fluidic devices” more dissimilar in scale than an etched microfluidic chip and a wastewater plant. Unfazed, he started talking about “massively parallel” microfluidics.

    These people are snake oil salesmen; they know it, and they don’t care, as long as they get away with it.

  223. @Sam J.

    But..but..pious Jews in Israel are praying at the Wailing Wall to stop the virus from spreading. This must mean that they are innocent! Here is the news :

    “…On Sunday, mass prayer session will be held at the Western Wall in the hopes of stopping the COVID-19 epidemic.

    COVID-19 is the name given to a new coronavirus, the outbreak of which began in Wuhan, China, late last year. The virus has already infected over 67 thousand people, and has killed over 1,500.

    The prayer session is initiated by Chief Rabbi of Tzfat and President of the Rabbinical Community Association Rabbi Shmuel Eliyahu; in partnership with the OU ISRAEL and its Rabbi Avi Berman; and the Rabbinical Community Association, led by Rabbi Amichai Eliyahu.

    The prayer session, scheduled for Sunday at 4:40p.m., will include a mass prayer session initiated by Rabbi Eliyahu, Rabbi Avi Berman, Rabbi Amichai Eliyahu, and other rabbis.

    Many Chinese Embassy officials will also take part in the prayer, which will include Psalms, Mincha (the afternoon prayer), and Ma’ariv (the evening prayer).

    “As Abraham’s sons, our father is committed to every person created in the image of God,” Rabbi Eliyahu said.

    “The people of Israel in their role are praying for the world, as a light to all nations and with the essential values ​​of family, studying, education and purity, we are committed to every person as he is a person. The fact that our prayers have immense impact, requires us to pray for peace and for good in the world…”

    Source : Arutz Sheva, 15/02/20 : Thousands to pray at Western Wall for end to COVID-19 epidemic.

    This is the final proof that the Jews are innocent! Honest!

    • Replies: @Culpepper
  224. CanSpeccy says: • Website
    @denk

    Those who subscribe to the insane conspiracy theory that this is a Chinese FF on their own people,….
    are defying logic, probability and overwhelming circumstantial evidences.

    I say FUCK YOU !
    CANSPECCY AND WHITEWOLF

    Denk is not only obnoxious, but apparently unable to understand the English language. Hence his false allegation that I subscribe to any theory concerning the Covid19 epidemic. Still, that a ChiComm. troll protests so insanely about a theory that no one holds certain or even probable, raises a question as to what they are trying to cover up.

    • Replies: @denk
  225. eah says:
    @Mark R

    Thanks — so it appears they think they have traced “GENOMIC AN (sic) PROTEIN SEQUENCES OF THE 2019-nCoV CORONAVIRUSES” that can be used to identify the virus back to “THE HK-3 CoV FROM 2005” — but it doesn’t really say anything about the role of these sequences in pathogenicity, only in identification — also your link doesn’t really seem to support the weaponization claim, which is what I’m most interested in:

    UPDATE – 2/9/2020 – IPAK HAS CONDUCTED FURTHER, IN-DEPTH STUDIES OF THE GENOMIC AN PROTEIN SEQUENCES OF THE 2019-nCoV CORONAVIRUSES AND THEIR RELATIVES AND HAVE COMPELLING RESULTS OF A KEY SIGNATURE USEFUL FOR IDENTIFYING A PARTICULARLY PATHOGENIC CORONAVIRUSES LINEAGE. GIVEN THAT WE HAVE FOUND THIS SIGNATURE, A FUNCTIONAL MOTIF FINGERPRINT, PRESENT IN THE HK-3 CoV FROM 2005, WE BELIEVE THIS EXONERATES RECOMBINATION IN THE LAB AS A SOURCE OF THE VIRUS. THIS DOES NOT EXONERATE ACCIDENTAL RELEASE, HOWEVER. WE ARE WORKING TO PUBLISH OUR FINDINGS.

  226. denk says:
    @CanSpeccy

    either the thing simply escaped from the Wuhan lab, or alternatively, it was deliberately released, in an attenuated form, to evaluate control measures for use in in the event of a real bioweapon attack.

    https://www.unz.com/article/how-to-yellow-cake-a-tragedy/#comment-3712319

    YOu say it in your typical forked tongue style of course. !

    • Replies: @CanSpeccy
  227. bluedog says:
    @Delta G

    What an idiot with only a post that an idiot troll would post, but then again the other idiot trolls all rush to agree.If you don’t like the site don’t come here I’m sure no one will notice your gone.!!!

  228. The Three Gorges Dam would be a nice target for the U. S. military … thanks for the idea!

  229. anonymous[340] • Disclaimer says:

    Much of interest in this blog entry:

    https://harvardtothebighouse.com/2020/01/31/logistical-and-technical-analysis-of-the-origins-of-the-wuhan-coronavirus-2019-ncov/

    – Following the aforementioned bat coronavirus bio-engineering research that was critiqued for being too risky in 2015, in the paper from UNC eventually published the next year that describing their successful bio-engineering of a highly-virulent coronavirus derived from bats, researcher #8 is listed as one “Zheng-li Shi” attached to the “Key Laboratory of Special Pathogens and Biosafety, Wuhan Institute of Virology, Chinese Academy of Sciences, Wuhan, China.”

    – Zhengli Shi seems to have returned to Wuhan at some point since 2016, specifically to the Wuhan Institute of Virology’s Disease Engineering Technical Research Center,  since she then appears in this September 2019 paper on the human behaviors most likely to lead to bat-borne coronavirus exposure in southern China, and in this pending preprint on the current outbreak of 2019-nCoV – just a sample of the dozens of coronavirus-related papers she’s published over a three decade career. And not only does she provide a direct chain of expertise tying the already successful bio-engineering of a virulent bat-based coronavirus at UNC directly to the BSL-4 virology lab in Wuhan, but back in January 2014 she’d received a $665,000 grant from NIH for a study titled The Ecology of Bat Coronaviruses and the Risk of Future Coronavirus Emergence (NIAID R01 AI1 10964) as well as $559,500 more from USAID for a study titled Emerging Pandemic Threats PREDICT_2China (Project No. AID-OAA-A-14-00102). Beyond this American funding specifically into viral diseases zoonotically transferring from animals to humans which would slipped in just before the ban, over the years she’s also received around $3 million in grants to study these zoonotic viruses from China and other countries, and has served on the editorial board of several virological research magazines. More of her research into the intersection of coronaviruses like the Wuhan Strain and their epidemic potential was funded by the U.S. Department of Defense, the U.S. Threat Reduction Agency, and U.S. Biological Defense Research Directorate of the Naval Medical Research Center.

    – And so a scientist who’s been prolifically involved with studying the molecular interaction of coronaviruses and humanity, spending decades and millions of dollars, and having even helped build a hyper-virulent coronavirus from scratch at UNC – just so happens to be working at the only BSL-4 virology lab in China that also just so happens to be at the epicenter of an outbreak involved a coronavirus that’s escaping zoological classification and whose novel spike-protein region shares more in common with a commercial genetic vector than any of its wild relatives, and has other unnatural characteristics that will be discussed below.

    • Replies: @utu
  230. Alfred says:
    @Ber

    Of course the problem lies in the identification of such personnel. Nevertheless, if such a message goes out, it will have a chilling effect.

    I suspect the Chinese and Russians know exactly who those who give the orders are. I agree that targeted assassinations are best. Next time the guy opens his front door, someone shoots him dead in front of his kids. The more publicity the better. Put a video on Youtube of the guy drowning in his own blood and his wife in hysterics.

    We are dealing with cowards here. They will get the message very quickly. Washington is like a big village and all these decision makers live in a handful of zip codes. They think that they can drone anyone anywhere and that there is never any retribution.

    BTW, I hope that those 100+ soldiers who have a “headache” include some drone operators and maintenance people.

  231. @Desert Fox

    Desert Fox said it well. Russia and China know what the US is up to and will dish something back to the US at a time of their choosing. I double that the Trump admin or Congress actually know the black operations that are being done in their name. Even so, they are guilty as hell.

  232. Pupila says:

    interesting article, 🧐 given the fact that George Soros & Bill Gates talk about how to depopulate and slow down environmental damage. George soros owns the lab in Wuhan were deadly virus are studied, Bill Gates talks about a vaccine to eliminate population. George soros and Bill Gates wanted to use socialism or a totalitarian government to control population. This coronavirus might be the weapon this wealthy men have set free and test in overpopulated communist China were people have no right to talk and have control social media. The environmental agenda has been pushed harder this past year using all that is in their power. George soros is old and he won’t die with out seeing his mission become a reality. Hitler had a depopulation agenda which he kept under wraps, until so many millions of people disappeared that the world started figuring out what was happening. Bill Gates and George Soros are also all about depopulation, but there’s no way they’re going to come right out and say it … or has Bill already done so? Bill Gates, along with George Soros are planning on reducing the world’s population by about 5 billion. What if this is the virus that supposed to eliminate the 5 billion people this two planned for.

    • Replies: @Anon
  233. Executive Summary of 20 days of research

    It is not even certain that it IS a virus or that it is dangerous. It is only so on condition that we are told the truth about the properties of the Coronavirus.

    If it turns out that there are other secret reasons than what we are told, there is a danger of confirming a false story.

    This also applies to alternative media: Both mainstream and alternative media accept the premise of the story itself of the virus and its postulated properties. Although mainstream and alternative media are in opposition to each other, BOTH confirm the premise; that it is a virus that is the cause, although there may be another cause (s).

    Everyone juggles axiomatically in the smallest detail on the premise that virus is the cause – that it has certain properties, whether it can be biologically created in a laboratory, whether it has a high or low risk of infection (R_0), death rates, censorship, etc – and enormously complex thought cathedrals are subsequently created based on the basic assumption (axiom). These thought cathedrals and constructions may be in opposition to each other, but all operate from the basic assumption; that it is a virus that is the cause – and 99% of all analysts exclude all other causes.

    For the sake of doubt, we can, for example read a little by Jon Rappoport (Big Pharma Specialist, Vaccines and Pandemic), Pulitzer-nominated journalist and veteran in Deep State analysis, who draws attention to this potential trap, challenging the basic premise of the virological paradigm:

    [MORE]

    ‘One of my main points was: there is no good reason to believe A VIRUS is causing illness and death.
    “But it HAS TO BE a virus.”
    There are certain lies people cannot reject, under any circumstances. Why?
    “If I reject this one assertion and call it a lie, then other dominos start to fall. What else would be a lie? What other foundation stone of reality would turn out to be made of air? How many authorities would I end up disbelieving? All my life, I’ve relied on experts to tell me what reality is all about. I can’t make a switch. It’s too much. THEREFORE, the experts are always right. That’s my logic. Or my leap of faith. My religion.”
    In this article, I’m not going to recapitulate all the evidence I’ve already presented about the coronavirus as a fake cover story. But I do want to give you some detail about how the cover story is being deployed, as we speak. Some people are consciously using it; others are following suit, for their own reasons, or out of sheer “addiction.”……Deeper and deeper the cover story goes. AND REGARDLESS OF WHICH SIDE OF A DEBATE PEOPLE TAKE, BOTH SIDES SUPPORT THE VIRUS AS THE CAUSE. That’s how good cover stories work: you get people disagreeing on details—while underneath it all, they automatically buy the central lie, the central unproven assertion. The big one. https://blog.nomorefakenews.com/2020/02/12/the-virus-first-last-and-always-in-the-hearts-of-our-countrymen/

    NB! Regardless of the real danger of the virus, if the virus is the cause, it is certain that:

    (a) China HAS been put on a standstill and quarantined – WITHOUT PRECEDENCE in history – with hundreds of millions of people in lockdown (New York Times correspondent now says 760 million people), and that

    b) the broken global supply lines as a result, WILL hit us in the West within a few months – lots of high-level documentation and preliminary indicators for this, such as:

    * Nearly 20% of S&P 500 companies have already warned investors about virus impact
    https://www.cnbc.com/2020/02/14/nearly-20percent-of-sp-500-companies-have-already-warned-investors-about-virus-impact.html

    * Why Covid-19 Demands Our Full Attention This is an unprecedented moment for our hyper-connected plane. The global economy is more interdependent than ever. Its supply chains are built on a huge network of dependencies with many ‘single points of failure’ strung along its many branches. Can anybody predict what will happen next? No. But we’re already seeing early failures as Chinese plants, factories and ports sit idle from the country’s massive quarantine efforts: https://www.peakprosperity.com/why-covid-19-demands-our-full-attention/
    * Coronavirus could deliver major hit to world economy https://www.wsws.org/en/articles/2020/02/12/coro-f12.html
    * Coronavirus: Deutsche Post stops sending packages to China The world’s largest courier company has said it will halt package deliveries to China for logistical reasons. https://www.dw.com/en/coronavirus-deutsche-post-stops-sending-packages-to-china/a-52385711
    * China Is Disintegrating: Steel Demand, Property Sales, Traffic All Approaching Zero https://www.zerohedge.com/economics/china-disintegrating-steel-demand-property-sales-traffic-all-approaching-zero
    * ‘… virtually all of China – and all those critical supply chains that keep companies across the globe humming and stocked with critical inventory – remain on lockdown.’ – China Has Ground To A Halt: “On The Ground” Indicators Confirm Worst-Case Scenario https://www.zerohedge.com/economics/china-has-ground-halt-ground-indicators-confirm-worst-case-scenario

    THIS is a huge danger, extremely complex, yet simple, and it is completely under-reported in the press: Economic interdependence today is Alpha & Omega; China produces extremely much to the West, antibiotics, substances to produce antibiotics, auto parts, high-tech parts, etc …. ad infinitum.

    Only one part is missing, the global chain reaction is affected (and we are just talking about a single global supply line out of countless). It is already affected, but the effects are not yet visible in the individual’s reality. The seemingly abstract has not yet actually found itself in teh West!

    The other dangers are the introduction of:

    * Biological Patriot Acts – Radical Precautions. Wuhan is the new 9/11.
    * The restructuring of society during economic crisis combined with pandemic
    * Dangerous possibly mandatory vaccinations (New vaccines will permanently alter your DNA ‘- Jon Rappoport)
    * Acceptance of restriction of freedom of assembly, freedom of movement during Pandemic / infection risk
    * Further loss of liberties, super-centralization of control, then
    * Introduction of world currency (SDR) and cashless society in the wake of economic collapse. The criminalization of cash

    There are at least 3 aspects of all this:

    1) Freedoms – Additional Restrictions, Biological Patriot Acts, Supercentralization, Danger to Dissidents, etc.

    2) The virological aspect that causes VS other potentially secretive causes (prions, chemical, etc,)

    3) Economic domino effect globally in the supply chain

    We know from Event 201, the Bill Gates Foundation, and other indicators that the super elite has had prior knowledge of the pandemic and Corona.

    UPDATE 15. february: Nearly 10k Military Personnel From 110 Nations In Wuhan China Weeks Before Coronavirus Outbreak!

    ______

    Important to consider also:

    TWO YEARS AGO, february 2018 — Joe Imbriao WARNED about:

    :
    * 5G Weaponry Will Induce INFLUENZA-VIRUS Symptoms To Force Mandatory Vaccinations (12:30) – (NB! Wuhan was stronghold of 5G test)
    * Crash global economy (check -in the process)
    * Depopulation
    * Martial law (check – in the process, China is under de facto Martial Law)
    * Curtail traveling (check – in the process)
    * Eliminate cash worldwide (China has now OFFICIALLY started to quarantine CASH )

    Se footnote [1] – potentially very deep rabbit hole!

    As I also said from DAY ONE – cash can be declared a danger. voila:

    China Quarantines Cash to Sanitize Old Bank Notes From Virus
    Bloomberg News
    15. februar 2020
    https://www.bloomberg.com/news/articles/2020-02-15/china-quarantines-cash-to-sanitize-old-bank-notes-from-virus

    Daily Mail 15. februar: China disinfects BANK NOTES and quarantines them for 14 days https://www.dailymail.co.uk/news/article-8006897/China-quarantines-BANK-NOTES-bid-stop-spread-coronavirus-death-toll-climbs-1-526.html

    ____

    Comment from forum: People who doubt that the Coronavirus is a big deal go on and on about how this is just a big PSYOP and scare tactic and nothing to worry about. Fucking hell, if they are quarantining millions of Chinese, disrupting world trade from China, spreading global pandemic fear to the masses, trying to push for a new vaccine to “cure” this, using this as a cover to kill Chinese dissidents or any other reason or combination of reasons, that is still a big fucking deal! Someone has managed to plunge most of the planet into pandemic mindset for whatever reason which means that there is still a big happening brewing on the horizon. They wouldn’t just push this shit for no reason, even if the virus itself was no more than a common flu. China is losing face in the eyes of the world and fear of disease is spreading around the planet. If this is just a PSYOP in motion, something is fucking happening man! There is still something ominous looming just around the corner here….

    ____

    Ultimately, the most important thing is; the liberation from the psychological virus, false dangerous beliefs, because it determines all subsequent actions or non-actions ……
    The awakened are carriers of the psychological anti-virus in the long term in relation to current and future lies, not least the willingness to accept any. mandatory vaccines and restrictions in the future.
    At least they will not believe the lies and official sources that many gullible unfortunately do.

    By our calculations 760 million are living under some kind of residential lockdown.
    – New York Times udenrigskorrespondent fra Shanghai
    https://www.confirmationbias.io/?p=20198:

    Chinese doctors say Wuhan coronavirus reinfection even deadlier -Instead of creating immunity the virus can reportedly reinfect an individual and hasten fatal heart attack
    https://www.taiwannews.com.tw/en/news/3876197

    Hubei Doctors Warn Of Even-Deadlier Coronavirus Reinfection Causing Sudden Heart Attacks
    https://www.zerohedge.com/health/hubei-doctors-warn-even-deadlier-coronavirus-reinfection-causing-sudden-heart-attacks

    * WHO accused of ‘delaying’ response to coronavirus outbreak to appease China
    https://www.news.com.au/world/asia/who-accused-of-delaying-response-to-coronavirus-outbreak-to-appease-china/news-story/

    * Croatian Post Suspends Delivery of Small Packages from China

    * Deutsche Post stoppt Paketversand nach China
    https://www.spiegel.de/wirtschaft/unternehmen/wegen-covid-19-deutsche-post-stoppt-paketversand-nach-china-a-39f5180a-9964-48cc-af0b-5fe24cd5c18a

    “Tankers, Tankers. Everywhere!” – Virus Causes Historic’ Traffic Jam’ Across Asian Supply Lines
    https://www.zerohedge.com/markets/tankers-tankers-everywhere-virus-causes-historic-traffic-jam-across-asian-supply-lines

    We found that our posterior estimates of basic reproduction number (R) in Wuhan City, China in 2019-2020 is calculated to be as high as 7.05..
    https://www.medrxiv.org/content/10.1101/2020.02.12.20022434v1

    Los Alamos National Laboratory “The Novel Coronavirus is Highly Contagious and More Infectious Than Initially Estimated”
    ‘…we estimated that the number of infected individuals during early epidemic double every 2.4 days, and the R0 value is likely to be between 4.7 and 6.6. We further show that quarantine and contact tracing of symptomatic individuals alone may not be effective and early,strong control measures are needed to stop transmission of the virus”
    https://arxiv.org/ftp/arxiv/papers/2002/2002.03268.pdf

    _______

    [1]

    Here the water molecule in relation to 4G and oxygen in relation to 5G are mentioned again:

    The need for speed has the consequence of going from moderate to severe health effects in record time. Note that 4G operates at 2.5 GHz or oscillates about 2.5 billion times per second.
    This frequency mimics water molecules in your body, and was chosen specifically for broadcasting services and equipment under government license. This means that all company products must meet this frequency or be deemed illegal.

    For what purpose is matching the human body’s frequency, you may ask, other than for weaponization? Good question. [….]

    …Because 5G frequencies affect oxygen molecules, they affect all biological systems, including DNA, circadian rhythm, heart function, hormonal regulation, and immune system.

    https://www.activistpost.com/2019/07/will-5gs-dramatic-problematic-health-issues-be-worth-humans-suffering-since-no-health-nor-environmental-safety-assessments-ever-have-been-undertaken-to-prove-non-thermal-radiofrequencies-cau.html

    ….and things like Magnetobiology are a parallel curriculum that most education-damaged doctors, biochemists, biologists, etc. are not aware of, because it is intentionally dimmed and kept out of the ordinary parrot curriculum for decades:

    Magnetobiology: Underlying Physical Problems by Vladimir N. Binhi

    You should read Health and Light: The Effects of Natural and Artificial Light on Man and Other Living Things by John Ott.
    https://www.politicsforum.org/forum/viewtopic.php?t=173630

    The maximum dielectric loss of water molecules begins at. 2.4 GHz
    https://thefullertoninformer.com/cell-towers-and-wireless-microwave-emisissions/

    IF THIS IS TRUE, IT’S THE BACKBONE of The NEW WORLD ORDER’S INFRASTRUCTURE of TOTAL CONTROL:

    Imbriano stated that 5G’s 60GHz bandwidth was selected for a specific reason, he thinks this reason may be to negatively affect the oxygen we breathe as part of a population control mechanism:

    “60GHz is the frequency of oxygen molecule absorption. Oxygen molecules have electrons that they share with each other, oxygen is a diatomic molecule. What we breathe are two oxygen molecules stuck together with these electrons that they share.”

    Imbriano appears to be correct, Oxygen is 98% energy absorbent at 60GHz. Oxygen absorption at 60GHz also severely limits wave range. They could have easily chosen any other wavelength and boosted travel distance, but instead opted for 60GHz, this has to be intentional. Graph source.

    While at 60GHz the frequency is non-ionizing (doesn’t eliminate electrons), it appears to disproportionately affect diatomic oxygen’s electrons without having a full-blown ionizing effect.

    Imbriano then stated that oxygen itself would be manipulated by 5G signals and made defective:

    “When oxygen is hit with 60GHz waves, it affects the orbital properties of those shared electrons. It is those shared electrons that bind to the hemoglobin in our blood, that is a magnetic compound in our body, in our blood cells. Hemoglobin is a very complex magnetic compound, it is a ferromagnetic compound. When you alter, or interfere with the orbital spin properties of diatomic oxygen’s (O2) electrons – you interfere with the gaseous exchange in our lungs where the oxygen is absorbed into the bloodstream, and at the same time is being transported through our body carbon dioxide and water vapor is being expelled from our bloodstream, into our lungs and exhaled. They’re taking the axe to the trunk of the tree, oxygen is life. They’re going to be poisoning us with a frequency that affects the oxygen molecules and this is by design.”

    “By their own admission they tell us that these emission don’t travel far, and that they don’t penetrate very well; and that requires that they locate these micro-cell antenna about every 500 feet in the cities – because the air in the atmosphere will absorb and block the frequencies (they want the air to do this). Why would they use that frequency if it doesn’t travel very far and there’s so many things that will interfere with the wave propagation? I’ll tell you why folks, it’s a weapon.”
    https://thuleanindependent.wordpress.com/2018/04/17/5g-directed-energy-weapons-and-the-impact-of-electromagnetic-frequencies-on-human-biology/

    5G might be a weapon – if this guy in the 2018 video – who is still light years ahead of anyone else’s info on 5G – is right, then it’s really TOTALLY crazy (false flag, financial breakdown will not occur until 5G is in place in that case ):

    https://thefullertoninformer.com/5g-dangers/

    __________

    Former writings:

    Nor is Corona like the previous epidemics. You don’t smash China, shut down 760 million people in lockdown, stop the economy – and thus the West’s economy in the long run – “only” to sell vaccines. This is much greater, regardless of the degree of real danger of the virus,

    Bottom line is: Corona is the world’s biggest problem-response solution so far: 1. virus = 2. fear = 3. population control.

    Corona is the new 9/11 – or at least the first phase of it …..

    AGAIN FOR THE 20TH TIME: “Only three months ago, the John Hopkins, Bill and Melinda Gates Foundation and the World Economic Forum (a hive of self-proclaimed globalists) organized a” pandemic simulation “called” Event 201 “OFFICIAL CHANNEL FOR THE CORONA EXERCISE LAST YEAR : https://youtu.be/AoLw-Q8X174) that focused specifically on Coronavirus, not Ebola or swine flu or even bird flu – but CORONAVIRUS. The simulation was about the spread of Coronavirus in South America, where animals were blamed for humans being infected ( of pigs) The conclusion of this exercise was that the national governments were nowhere prepared to score 40 out of 100 on their contingency scale, the simulation predicted over 65 million deaths worldwide.

    Event 201 played out almost exactly as in China today. Some very sincere or maybe rather stupid people have argued that this type of thing is “normal” and claim that we are “lucky” that the elites have run simulations beforehand to “save us” from a coronavirus outbreak. I argue that event 201 was not a simaltion, but a war exercise to study the possible outcomes of an event that globalists already knew was coming. Disregard the fact that, before almost every major crisis and terrorist attack in the last few decades, authorities ran simulations of how the exact event took place just before it happened; does anyone really think Event 201 is pure coincidence? ”

    Many conspiracy authors are now in cognitive dissonance, just as they were immediately after 9/11. It took time to de-program itself from the bias of normalcy bias and cognitive dissonance, and only after thorough analysis of many aspects. There is a difference between fear and facts. Many people confuse the facts with their own fear-reaction and throw the baby out with the bathing water … they switch verbs and subects because of their own cognitive dissonance / fear __- what have you, and think the description is ‘hysterical’ because they don’t can relate to what is described. Have they examined the many aspects of Corona? NO! Still, they run on their Polyanna knee-jerk jerk reaction … like many educationally damage-educated doctors …

    AGAIN: It is not Corona that is the most dangerous, but financial contagion, not least the perception mangement and social engineering it leads to: cover for economic collapse and population control, and introduction of SDR (world currency) and cashless society, acceptance of Minority Report control

    Now I do not know how dangerous it is – China suppresses information. If you buy the premise, again – it’suseless to compare it with previous fraud epidemics and fear campaigns, because the rate of infection is greater (R0) than ordinary flu, and we do not know the true R0 yet, but China’s behavior suggests total panic. In addition the long incubation and being without symptoms is also a gamechanger

    But again: Corona is not the most dangerous, but financial contagion is, not least the perception mangement and social engineering it leads to:

    • Replies: @Commentator Mike
  234. It seems like so many in the fucktards haven’t experienced war that they forgot or don’t know how horrible it is.

    China can fucking fight back you epic retards.

    One of the only two in the world that can actually fight back vs USA. Get that through your fucking retarded brains.

    I hope to hell and back that this shit is not a American made bio weapon. And I am moving out of NYC as soon as I am able. Time to buy a house in some remote place away from all big population centers. All I need is internet access.

    Fuck the crazies.

  235. @Agent76

    Francis Boyle could be wrong too. His opinion just good enough to put in consideration.

    NEVER LISTEN CHINA UNCENSORED!!!!

    • Agree: utu
    • Replies: @Agent76
  236. Truth says:

    I suspect the Chinese and Russians know exactly who those who give the orders are. I agree that targeted assassinations are best. Next time the guy opens his front door, someone shoots him dead in front of his kids

    Does this mean that you are volunteering for the job? Great, then nothing will change.

  237. Truth says:

    Well let’s try to make a summation based upon an 85 IQ perspective here:

    There are three posible causes of the so-called “coronavirus;”

    1- It is a CIA/US created weapon of war.

    2- It is Chinese created, and was accidentally released, or somehow got out of hand it their own country.

    3- It is Chinese created and was intentionally released.

    4- It is a naturally occuring biovirus from animals.

    Of the four, #4 seems the most farfetched as while, obviously, my IQ is too low to be a bio-chemist, It seems as though this disease jumping from bats, or pangolins to humans in one month, devastating bodily organs and shutting down a province seems, well, far-fetched.

    #1 as demonstrated by this article, seems a distinct possibility, except for one thing. We keep hearing about this vast network of spying and counterspying, so how did China have no idea this was coming? We knew of the upcoming Pearl Harbor attack 2 weeks in advance 50 years before the internet. Also, this would be believing that the global governments of the world’s two largest superpowers operate autonomously. I belive this is false. Think of them like too pirates who combine their crews; they may argue about how to divide the booty afterwards, but they will conspire to take over your ship and toss you overboard. I believe that at the top, there is only, truly, one government with a group of franchises.

    #2 seems equally illogical to me as had somebody “dropped a flask” while shopping for pangolin at the Wuhan market, the response would have been much quicker, and why would they have waited until a week into the epidemic, to have constructed a 10-day “hospital” (with no bathrooms)? If an accident had happened it would have been one phone call to Hubei central headquarters, followed by one, on the red phone, to Beijing, and a swift response right away.

    That leaves us with #3, in my humble opinion the most logical possibility; Imagine if you will, if, say 40% of the sick, elderly, and interned people in America were to die in a six-month period? How would things change? 40% of the S.S. and Medicare budget eliminated; hundreds of thousand of homes deeded to young people overnight, etc., etc. Now ask yourself, China is upon the precipice of “taking over the world,” so to speak. What possible way better way of cultural vitalization, could the world’s most pragmatic government, saddled with the world’s most elderly-centered culture, come up with?

    Overnight, (or let us say within 12 months) millions of youn, and middle aged Chinese will be unburdened from the responsiblility of caring for infirmed and elderly parents and grandparents who might live another 30 years? Unlike in our country, from my understanding, this care is a personaly responsibility, not a “benefit” of the nanny state, as it is here. It is my understanding the the disease effects mostly the elderly, and those who are already sick.

    Within a few months, young people will inherit their parent’s apartments, whatever nest egg they will have, and will be freed, monetarily, to have children, invest more money, and go forth to colonize new Hangcouvers, all ove the world.

    I don’t speak or write Chinese, but here you go, Mr. Metallicman, what if the whole “Coronavirus thing was simply Beijings way of saying…

    好 婴儿潮

    • Replies: @thetruth
  238. @Steve Naidamast

    I agree with this. Even the black death wasn’t all about bubonic plague as the death rate of same just isn’t that high. It had more to do with famine, sanitation, quack medicine and lumping carious thing together under one name.

  239. utu says:
    @anonymous

    This writeup

    https://harvardtothebighouse.com/2020/01/31/logistical-and-technical-analysis-of-the-origins-of-the-wuhan-coronavirus-2019-ncov/

    by a ‘former’ spook is interesting however it is written to steer to only one desired conclusion that it was the Chinese who did the alteration of the virus and they released it. The key argument hinges on Chinese researcher Zhengli Shi from Wuhan who in 2015 while at the University of North Carolina worked on coronaviruses. So the spook writes a very loaded sentence:

    “…the precise region altered by Zhengli Shi at UNC to make a hyper-virulent strain of coronavirus, and whose alteration and adaptation would explain the Wuhan Strain’s unusual behavior as discussed above.”

    However the 2015 paper that came fromUniversity of North Carolina had 15 co-authors and Zhengli Shi was one of two Chinese among them.

    SARS-like cluster of circulating bat coronavirus pose threat for human emergence (2016)
    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4797993/

    I would rather concentrate on the chief author Ralph Baric of UNC:

    Lab-Made Coronavirus Triggers Debate (2015)
    https://www.the-scientist.com/news-opinion/lab-made-coronavirus-triggers-debate-34502

    Ralph Baric conducted his research despite of the 2013 Moratorium on Gain-of-Function Research

    https://www.the-scientist.com/the-nutshell/moratorium-on-gain-of-function-research-36564
    In the wake of a handful of biosafety lapses at federal research facilities, the US government is temporarily halting funding for new studies aiming to give novel functions to influenza, SARS, and MERS viruses

    The same Ralph Baric in late January this year issued the following never-mind-don’t-worry statement:

    “US residents should be aware about the #2019nCoV but be more concerned about the flu virus. Get your flu shot if you haven’t already!⁩ ”
    https://twitter.com/david_rmartinez/status/1222502006356684800?s=12

    • Replies: @utu
    , @anonymous
  240. CanSpeccy says:
    @denk

    YOu say it in your typical forked tongue style of course. !

    No, I don’t say it. However, scientists at China’s South China University of Technology in Guangzhou say that: “the Wuhan lab is the most likely source of the the novel Corona virus”:

    Botao Xiao and Lei Xiao. 2020. The possible origins of 2019-nCoV coronavirus
    …We noted two laboratories conducting research on bat coronavirus in Wuhan, one of which was only 280 meters from the seafood market. We briefly examined the histories of the laboratories and proposed that the coronavirus probably originated from a laboratory.

    A plausible hypothesis, since the Wuhan lab would naturally be researching such disease agents, if only in the pursuit of a remedy. But that apparently is a concept too difficult for Donk to grasp.

    • Replies: @utu
    , @denk
  241. Doxocopa says:

    Well… by now I rather have a strong opposite and uneasy suspicion caused by:
    1 – By now there isn’t a single DEATH from Coronavirus reported OUTSIDE CHINA. There are cases, especially the cruise ship in Japan Statistically this is very odd and smells a rat here.
    2 – Chinese Gov has apparently ordered 7 MILLIONS corpse plastic bags.

    3 – also, according to the above video there are no virus specialists in the teams fighting it. WHAT???

    My number one theory now is:
    May be or may be not we have a serious viral issue… but China`s CP gov wants to get rid of 5 MILLION to 7 MILLION of its people already identified with Google help Social credit system ID in a culling process undercover by this rat smelling Virus epidemic.

    Communists have ALWAYS reported to culling down their own populations when feeling threatened or loosing control (Honk Kong?). I really think what is going on is s typical communist culling ot their own population for political reasons (aka keeping control).
    By now the statistics

    • Replies: @thetruth
    , @Alfred
  242. bluedog says:
    @Bert

    Simple if you use your brains we want to stay number one and we will do anything under the sun including germ warfare in order to accomplish it.With China belt and road they will be number one in the very near future while we are busy bankrupting the country.!!

  243. This is not a probable attack on China. This is all on China. Though highly advanced, they often have surprisingly stupid and mediocre safety protocols (or maybe this was intentionally leaked). This probably came from that biolab *280 meters* away from the wet market the call “ground zero”, where researchers are doing stuff with bats that originate 600 MILES from Wuhan that CARRY THE CORONAVIRUS. Why? 1: they have tons of dissidents they can’t openly kill…THIS, however? Doesn’t really point back to them, aside from the lab’s coincidental projects and proximity to ground zero. 2: If this works out they way they may hope, they can take it international: no country wants the traceability of a nuclear attack, the following counterattack, mutual destruction, and post-war unliveability of both areas involved in a nuclear war.

    BIOLOGICAL war, however…let the disease burn out your enemy, flyover with antiviral drone bombardment, then move in and claim the land. China is overcrowded like a mofo, they NEED land, they are NOT our friends, but know that nuclear war will make that land unliveable. They’re just stepping up the primitive biowarfare siege armies used on fortified castles in Europe when they threw rotting bodies over castle walls to introduce sickness upon the people trapped inside, and the US army waged on native americans with smallpox-riddled blankets. If they continue, you can bet they’ll get Korea to launch the payload into California during so-called a “test-launch gone wrong” during one of Kim Jeong Un’s future tantrums. We need to examine ALL of China’s bio research labs, not their delegates, but people with no ties to China in the UN (not really sure how much anyone can trust *them*, though) and America who won’t lie to cover for them.

  244. Anonymous[353] • Disclaimer says:
    @clickkid

    It’s my fault.

    Online, offline.

    You have to be impossibly simple. Basic. Obvious. Or, people don’t understand you.

    What’s the argument.

    – The Virus targets Asians.

    – Why do people say it targets Asians?

    https://www.biorxiv.org/content/10.1101/2020.01.26.919985v1.full

    [MORE]

    – The Virus gets in via ACE-2 cell entry.

    – Asians have more ACE-2 cells.

    – Therefore the Virus targets Asians!

    – Who hates Asians?

    – Americans. (Except they don’t, fucking obviously, they marry them, have sex with them, love them and allow them to buy all the houses and get into top Colleges despite almost 100% cheating).

    Why is this wrong? Why is it so retarded?

    – The mother fucking Chinese created the ACE-2 pathway, in 2013.

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5389864/

    Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor

    – That ACE-2 C-Virus came from bats.

    – Chinese bats. The bats they eat.

    – The experiment said the virus could jump from bats to humans.

    – So an ACE-2 virus could be natural.

    – The Chinese fucking proved it.

    – ACE-2 pathway entry isn’t proof of a bio-weapon.

    OR slash AND

    – ACE-2 entry is China’s fault.

    – China isolated the ACE-2 bat Corona Virus in 2013.

    – China developed the Virus since.

    – In dual-purpose laboratories.

    – That aren’t fit for purpose.

    – That are pieces of shit

    – like the Wuhan apartment building, Google has hidden.

    – Their ACE-2 pathway virus got out.

    – So?

    – The Virus doesn’t fucking ‘target’ Asians.

    – Because China made the ACE-2 Corona Virus pathway

    – That the Chinese have more of.

    – They did it to themselves.

    Do you understand?

    This is what is sad.

    – Because of this

    – Anyone who says the virus ‘targets Asians’

    – Is implicating the Chinese government.

    – Because the Chinese government.

    – Celebrated their ACE-2 Virus

    – The ACE-2 Asians have more of.

    – As proof of their superior Asian superpowers.

    – In ‘Nature‘ journal, in 2013.

    – Look it up.

    – And stop lying.

    – At very best – the Chinese are active participants in this worldwide population cull.

    So if I’m Japanese, and I’m choking to death – don’t blame the Americans. Blame your friends the Chinese. Same with Singaporeans and everyone else.

    Is that simple enough?

    How much more simple can I make it?

    I can’t make it more simple.

    So China should attack America?

    For their own fuck-up.

    Or, their own betrayal.

    And if this was engineered.

    It wasn’t ‘America’.

    It was a set of individuals. Like Soros, like Gates.

    Target them.

    Not Americans in the mid-west who have to eat Spam on food-stamps.

    Because they’re serfs in a neo-feudalistic system.

    That wants to use Chinese social credit.

    To make that neo-feudalism permanent.

    And Chinese victimhood.

    Is a joke.

    Because we all now can see.

    Our future is being imprisoned in Chinese or Jewish camps.

    While ugly Chinese men.

    Rape our wives.

    With their Jewish friends.

    Like they’re doing to the Uyghurs.

    Right now.

    Thank-you, thank-you.

  245. utu says:
    @utu

    The correct title of the writeup by the ‘former’ spook is: Zhengli Shi, the making of a patsy

  246. thetruth says:
    @Alfred

    Here is the article Part II

    https://www.globalresearch.ca/the-geopolitical-deployment-of-biological-weapons/5703005
    “The Geopolitical Deployment of Biological Weapons
    Part II
    By Larry Romanoff
    Global Research, February 10, 2020


    Epilogue

    From the very earliest days of America’s bio-warfare experiments, US political and military leaders, as well as CIA officials, made no effort to hide their interest in developing methods of infecting individuals with cancer as a method of ridding themselves of national leaders they didn’t like, a method with perfect deniability. The US record of having assassinated by various means about 150 political leaders in other nations will attest to this assertion.

    “The attraction is that bio-weapons are not only very efficient mass killers but are quite cost-effective compared to shooting wars. As well, genetic weapons can be dispersed in a multitude of ways, using virus-infected insects or bacteria, or spliced into GM seeds. These weapons are difficult to detect and identify, and often a treatment or vaccine could be years in the making.”

    Dr. Leonard Horowitz, the famed pharma industry whistleblower, quoted one expert as saying he would plan a bio-attack

    “with subtle finesse, to make it look like a natural outbreak. That would delay the response and lock up the decision-making process. Even if you suspect biological terrorism, it’s hard to prove. It’s equally hard to disprove . . . You can trace an arms shipment, but it’s almost impossible to trace the origins of a virus that comes from a bug.”

    One author noted that a properly-done release of an infectious agent would make diagnosis and treatment difficult, adding that this kind of bio-warfare cannot be traced to its source and might be considered an “act of God”.

    • Replies: @Ber
  247. anonymous[340] • Disclaimer says:
    @utu

    Thanks for the stuff about Ralph Baric.

    conclusion that it was the Chinese who did the alteration of the virus and they released it.

    Well, I am very doubtful of the notion that the Chinese altered and released 2019-nCoV, although I wouldn’t personally rule anything out yet without more information.

    It has been known for many years now that coronaviruses have potential to be used as biological weapons. What I find interesting is that Zhengli Shi’s team at the Wuhan Institute of Virology seems to have been at the forefront of coronavirus research, especially those most similar to 2019-nCoV. The idea that they may have been getting funding from the West for studying animal to human transmission, among other things, is troubling to me. Some of the Wuhan Institute’s studies over the years seem to have revolved around ability of various novel coronaviruses to use ACE2 receptors to infect humans. Such funding means that certain sources in the US must’ve had quite an interest in the findings from these and other studies. While I will refrain from drawing any conclusions for now, I cannot shake off the notion that there may be a connection between all of this stuff and the current outbreak.

  248. @Anon

    I think the most coherent argument for HIV transmission was from Congo simian kidney cultures used in polio vaccines from 1955 to 1963. Some websites say “debunked” – yet some studies are still being revisited.

  249. utu says:
    @CanSpeccy

    Must be true since even Daily Mail (and The Sun, Mirror, Express, Daily Telegraph) reported it. You can always count on the British tabloids to forward the CIA/MI6 psyop narratives.

    The problem is that all the tracks to the alleged Botao Xiao and Lei Xiao publication lead to Zerohedge but also end there. Zerohedge hyperlinks to ResearchGate are dead. As far as ResearchGate and Google Scholar are concerned this publication does not exist.

    • Replies: @Ron Unz
    , @CanSpeccy
  250. thetruth says:
    @Doxocopa

    For what you wrote, you should be Rotten in HELL!

    If you knew how Chinese leadership, doctors and nurses, police forces, grassroots organizations, and army soldiers have been making EVERY humanly possible effort to save people’s lives there at this moment, you should DEFINITELY apologize for what you said!!

    • Replies: @Offthepink
    , @d dan
  251. SBaker says:
    @CanSpeccy

    “That is consistent, perhaps causally, with the finding of an “uncanny” resemblance of “4 insertions in the spike glycoprotein (S)… to amino acid residues in key structural proteins of HIV-1 “. These sequences are “unique to the 2019-nCoV and are not present in other coronaviruses”

    I posted this a week ago and it generated one comment. Most of the posters here are political, philosophical or conspiracy thought technuts. This novel corona virus is most likely engineered.

  252. thetruth says:
    @Truth

    your IQ is indeed worse than a 3 year old baby

    • Agree: utu
    • Replies: @Truth
  253. TKK says:
    @Alfred

    When your time comes, or you have a suspicious illness, let’s beat you to death with clubs. There’s no other humane way to end a beating heart.

    I volunteer to swing the first blows. In the meantime, why don’t you enjoy an antifreeze cocktail?

  254. JamesinNM says:

    U.S. shut off the oil supply to Japan to provoke Japan because of the economic threat posed by Japan to the U.S. and banker masters’ quest to dominate the world. Then the U.S. intentionally murdered Japanese with nuclear weapons to destroy their economy, etc. Pray for Christ’s return and the destruction of all evil. It is a spiritual war, so use spiritual weapons.

  255. Ron Unz says:
    @utu

    Must be true since even Daily Mail (and The Sun, Mirror, Express, Daily Telegraph) reported it. You can always count on the British tabloids to forward the CIA/MI6 psyop narratives.

    The problem is that all the tracks to the alleged Botao Xiao and Lei Xiao publication lead to Zerohedge but also end there. Zerohedge hyperlinks to ResearchGate are dead. As far as ResearchGate and Google Scholar are concerned this publication does not exist.

    Yes, this seems highly suspicious to me…

    I don’t read fringe-conspiracy websites like Zerohedge, so I hadn’t been aware that so many of them were promoting the theory that the Chinese had developed an anti-Chinese racial bioweapon, then carelessly released it against their own population (or perhaps did so deliberately to reduce Social Security costs). But the fact that such absurdly silly theories became so widespread so quickly, suggests that they were deliberately promoted in an organized fashion to preempt any emerging suspicions of a racial bioweapon. It also underscores the extreme gullibility and/or low IQ of conspiracy-people, as well as the likely corruption of conspiracy-websites.

    The notion that the Chinese deliberately developed an anti-Chinese racial bioweapon seems doubtful. The notion that they—Oops!!—then accidentally released it just before Chinese New Year, the worst possible time of the year seems doubly doubtful.

    Back in the 1960s, some federal official in Texas was supposedly involved in a massive corruption scheme with LBJ, and came under huge pressure from prosecutors to reduce his sentence by testifying. He was found dead, shot seven times. The local judge ruled it an apparent suicide, and it was reported as such by the national media.

    • Agree: utu, Ber
    • Replies: @CanSpeccy
    , @utu
    , @d dan
    , @Anon
  256. @thetruth

    The government covered it up and THREATENED doctors who wanted to inform the public…until the truth could no longer be contained. Typical China: lie and deny until it’s impossible to hide, then cooperate in an effort to look like heroes to shut the barn doors after the horses have all escaped…when they themselves could have contained the matter by acting in a timely manner and informing everyone instead of trying to save face and letting things become worse.

    • LOL: bluedog
  257. CanSpeccy says: • Website
    @Ron Unz

    But the fact that such absurdly silly theories became so widespread so quickly, suggests that they were deliberately promoted in an organized fashion to preempt any emerging suspicions of a racial bioweapon. It also underscores the extreme gullibility and/or low IQ of conspiracy-people, as well as the likely corruption of conspiracy-websites.

    That certainly puts you on the same side as the high IQ ChiComm propagandists like Denk.

    However, it ignores the fact that the highest level biohazard labs exist to research highly hazardous agents, including one must assume, warfare agents designed to harm one’s own people. Indeed other than research in pursuit of antidotes there is no legitimate reason for such labs, since the only other reason for them would be to create biowarfare agents.

    But if a lab has is working with a biowarfare agent, then that agent can escape, rather easily it would seem in the case of the Canadian lab, for example, where workers are not routinely search or scanned on departing the premises. And whatever the precautions in Wuhan, where until the other day you seemed to think it implausible that there could even be such a lab in such a populous place, dangerous agents may have been able to escape rather easily, which would explain why the leadership of the Wuhan lab was just transferred to a PLA General with expertise in microbiology. Certainly the possibility of escape due to accidental self-infection by a lab worker does not seem implausible. It could happen anywhere, unless every movement of every worker is precisely monitored every moment of every second that they are inside the lab.

    • Replies: @CanSpeccy
    , @utu
  258. utu says:
    @Ron Unz

    The pdf of Botao Xiao and Lei Xiao “The possible origins of 2019-nCoV coronavirus” paper was uploaded to SCRIBD by Zerohedge (205K views)

    https://www.scribd.com/document/447056518/Originsof2019-NCoV-XiaoB-Res#from_embed

    and by Palpatin (451 views)

    https://www.scribd.com/document/447078292/originsof2019-nCoV-XiaoB-Res-1

    yet all the links to ResearchGate are dead. The paper does not show up anywhere else but SCRIBD and Zerohedge.

    • Replies: @Mike P
    , @Anonymous
  259. CanSpeccy says: • Website
    @utu

    The problem is that all the tracks to the alleged Botao Xiao and Lei Xiao publication lead to Zerohedge but also end there. Zerohedge hyperlinks to ResearchGate are dead. As far as ResearchGate and Google Scholar are concerned this publication does not exist.

    That’s disappointing. I had taken the reported existence of the article as proof that something like free speech prevails in China. But apparently not.

    Based on the rule to believe nothing until it is officially denied, I suppose one should deny nothing until it has been officially proclaimed. I knew Research Gate was useless, but I didn’t know it was fake.

    I suppose it’s possible, though, that after posting the article, the authors were offered the choice of taking it down or receiving a bullet in the back of the head.

    • Replies: @d dan
    , @utu
  260. d dan says:
    @Ron Unz

    This commenter CanSpeccy is like a charlatan. He makes comments again and again that have been proved to be false, inaccurate or misleading. e.g. in comment #97 above, he claims that:

    “This is an RNA virus. It has no DNA.”

    Take a look at the official sequence of the virus posted in [1]. The following is the initial fragment: “attaaaggtt tataccttcc caggtaacaa accaaccaac ….” For the lay persons, DNA sequence consists of a, t, c, g whereas the RNA consists of a, u, c, g. Does the fragment looks like a DNA or RNA?

    [1] https://www.ncbi.nlm.nih.gov/nuccore/MN908947

    • Replies: @CanSpeccy
  261. CanSpeccy says: • Website
    @CanSpeccy

    Here’s an example of a deadly virus being simply walked out of Canada’s Level 4 Biohazard lab:

    Charged with smuggling in U.S., ex-Winnipeg researcher cops a plea

    CBC News · Posted: May 22, 2009 7:49 PM ET | Last Updated: May 24, 2009
    A former researcher at the National Microbiology Laboratory in Winnipeg accused of trying to smuggle genetic material from the Ebola virus across the Manitoba-North Dakota border pleaded guilty to a lesser charge on Friday.

    • Replies: @Parisian Guy
  262. Agent76 says:

    Feb 16, 2020 Coronavirus Feb 11th 2020 By Dr. John Bergman

  263. d dan says:
    @thetruth

    “If you knew how Chinese leadership, doctors and nurses, police forces, grassroots organizations, and army soldiers have been making EVERY humanly possible effort to save people’s lives there at this moment, you should DEFINITELY apologize for what you said!!”

    Thanks, thetruth. Yes, the haters just want to hate. They don’t care about people’s suffering. They don’t care about others’ lives. They don’t care about the sacrifices and dedication of tens of thousands of people working 24/7 and risking their lives and their family’s lives to fight the disease.

    p/s: If you click on Doxocopa or Offthepink, you will see that they are one-time posters newly created for this thread to propagate their hatred.

    • Replies: @Offthepink
  264. Anon[253] • Disclaimer says:
    @Ron Unz

    Tom Cotton is a young GOP senator from Arkansas with presidential aspirations. He’s a fervent neocon, although unlike some of the neocons like Kristol and Frum who oppose Trump, he’s embraced Trump, especially with respect to hawkishness against China and Iran. Cotton seems to be positioning himself to lead the post-Trump GOP with an ideology that marries aspects of Trumpism with neoconservatism.

    Cotton is also rumored to be CIA, and was almost appointed to be CIA director by Trump when Pompeo left CIA to become Sec of State.

    Cotton has been claiming that the coronavirus was engineered by China:

  265. d dan says:
    @CanSpeccy

    “That’s disappointing. I had taken the reported existence of the article as proof that something like free speech prevails in China. But apparently not.”

    No, you did not. You are (in comment #248 above) taking the article as proof that “the Wuhan lab is the most likely source of the the novel Corona virus”. Now, being challenged, you change your tune to say that your purpose of quoting the article is to prove that there is free speech in China.

    You are changing the topic to freedom of speech in China when the original topic was about source of the virus.

    Like what denk says, you are a forked tongue troll.

    • Replies: @CanSpeccy
  266. utu says:
    @CanSpeccy

    “I had taken the reported existence….” – This was your problem. You assumed the existence. Even some of the Zerohedge commenters seem to be more savvy than you.

    “The US consulate, it’s only 5 km away at 568, Jianshe Avenue Jianghan District, Wuhan” (2 h ago)

    “Article does not exist on Researchgate and I also can’t find both authors.

    Edit: the article is nowhere to be found on either google or googlescholar. Lots of references by news media to it, though.” – (5 h ago)

    “Or maybe it was discovered to be a forgery, a hoax written by random schmoes using the names of prominent Chinese scientists.” – (5 h ago)

    • Replies: @CanSpeccy
  267. Mike P says:
    @utu

    Here is one link to the paper that does not require jumping through scribd’s hoops

    https://img-prod.tgcom24.mediaset.it/images/2020/02/16/114720192-5eb8307f-017c-4075-a697-348628da0204.pdf

    • Replies: @utu
  268. utu says:
    @CanSpeccy

    It is likely that Denk has higher IQ score than you but he comes across poorly because of his poor English skills and narrow inflexible guidelines of his job (as a self-assigned troll) description. You on the other hand come across as very eloquent that some may mistake for intelligence but once the verbiage is filtered out usually not much is left except for a pretense.

    • Replies: @CanSpeccy
    , @denk
  269. CanSpeccy says: • Website
    @utu

    Even some of the Zerohedge commenters seem to be more savvy than you.

    Evidently you spend more time at Zero Hedge than I do, since I never read the comments.

    But the point that supposed article made; namely, that an escape from the Wuhan lab was possible and even quite likely is supported by the assessment of others who are presumably expert in the field. For example:

    Front Public Health. 2014; 2: 116.
    The Consequences of a Lab Escape of a Potential Pandemic Pathogen

    Lynn C. Klotz1,* and Edward J. Sylvester2

    …. Now is the time to address the next critical question: what is the likelihood that one of these viruses will escape from a lab and seed the very pandemic the researchers claim they are trying to prevent? As we shall estimate, that probability could be as high as 27%, a risk too dangerous to live with.

  270. CanSpeccy says: • Website
    @utu

    It is likely that Denk has higher IQ score than you

    Quite possibly, but as I have explained here, I think IQ is bullshit, so I am not greatly concerned to be judged disadvantageously on that basis. To you, as a true believer in IQ, Denk’s brilliance, despite an expository style heavily reliant on the imperative “fuck,” its gerund “fucking,” plus the imaginative derivative, “FukUS,” is no doubt obvious. “

  271. utu says:
    @Mike P

    The question is who took it down. There is no trace of this paper on ResearchGate now. But it seems it was there 5 days ago. Here it is on web.archive.org.

    https://web.archive.org/web/20200214144447/https://www.researchgate.net/publication/339070128_The_possible_origins_of_2019-nCoV_coronavirus

    • Agree: Mike P
    • Replies: @CanSpeccy
  272. CanSpeccy says: • Website
    @d dan

    You are (in comment #248 above) taking the article as proof that “the Wuhan lab is the most likely source of the the novel Corona virus”

    I am sorry, but you are a liar. I said at #248 that and escape from the Wuhan lab was “a plausible hypothesis,” a view supported by the literature reference I gave a 277.

    Poor English may be a plausible excuse for misunderstanding, but it is no justification for the lying accusation that I lied.

    • Replies: @d dan
  273. Anonymous[305] • Disclaimer says:
    @utu

    It’s incredible.

    That 2013 study cited above is the key. Yet it’s being totally ignored. Why?

    Look at what the Chinese did:

    [MORE]

    Construction of expression clones for human and civet ACE2 in pcDNA3.1 has been described previously29. Bat ACE2 was amplified from a Rhinolophus sinicus (sample no. 3357). Briefly, total RNA was extracted from bat rectal tissue using RNeasy Mini Kit (Qiagen). First-strand cDNA was synthesized from total RNA by reverse transcription with random hexamers. Full-length bat ACE2 fragments were amplified using forward primer bAF2 and reverse primer bAR229. The ACE2 gene was cloned into pCDNA3.1 with KpnI and XhoI, and verified by sequencing. Purified ACE2 plasmids were transfected to HeLa cells. After 24 h, lysates of HeLa cells expressing human, civet, or bat ACE2 were confirmed by western-blot or immunofluorescence assay (IFA).”

    It says, right there, that the fucking Chinese created amplified clones of Bat ACE-2 proteins in human/animal hybrids.

    Then you have this.

    https://www.ncbi.nlm.nih.gov/pubmed/20567988/

    Angiotensin-converting enzyme 2 (ACE2) proteins of different bat species confer variable susceptibility to SARS-CoV entry.

    By: Hou Y1, Peng C, Yu M, Li Y, Han Z, Li F, Wang LF, Shi Z.

    State Key Laboratory of Virology, Wuhan Institute of Virology, Chinese Academy of Sciences (CAS), Wuhan, Hubei, China.

    The discovery of SARS-like coronavirus in bats suggests that bats could be the natural reservoir of SARS-CoV. However, previous studies indicated the angiotensin-converting enzyme 2 (ACE2) protein, a known SARS-CoV receptor, from a horseshoe bat was unable to act as a functional receptor for SARS-CoV. Here, we extended our previous study to ACE2 molecules from seven additional bat species and tested their interactions with human SARS-CoV spike protein using both HIV-based pseudotype and live SARS-CoV infection assays

    2010 – Wuhan.

    Wait, what does that say?

    It says that the Chinese tested interactions of ACE2 molecules with

    HIV-based assays.

    They found bats with ACE2 that wasn’t a functional receptor, then they researched how to make ACE2 a functional receptor. Turns out one way to assist SARS-CoV cell entry is to add HIV-assays spikes to it.

    How simple do I have to make it. Are the block letters enough.

    ACE2 molecules +

    HIV-based assays in

    China in

    Wuhan.

    2010

    What did the Indians say? They found HIV Proteins in the genomic sequence.

    And you can keep going, tracing the Chinese development of their virus. All over the world.

    From the earlier study on their findings:

    “They also highlight the importance of pathogen discovery programs targeting high-risk wildlife groups in emerging disease hotspots as a strategy for pandemic preparedness.

    It says it in the study. You don’t even have to read more then about 40 words. Can you do that?

    The Chinese recommended pathogen study programs in international species incubation zones. Why wasn’t that in Whitney Webb’s piece?

    Do I have to do a simple goy version for this as well?

    Not only does that 2010 Wuhan study show the Chinese engaged in HIV-SARs-CoV recombinant research in Wuhan. It shows that they were experimenting to find out the most efficient ACE2 pathway for cell entry for the Virus. Using HIV assays.

    And Asians have the highest ACE2 in the world. So it was insanely risky.

    And remember – on all these research papers are the names of Chinese, and Jews. Jews and Chinese. Such a potent combination of superior IQ right? Right? Superior? Lol. Nope. The Chinese were always going to get betrayed. But they were arrogant enough to think they were different.

    The experiment shows they had ACE2’s that weren’t functional receptors in bats. So they were experimenting to make them functional. By inserting HIV assays. And they were running comparisons which compared Bat ACE2 receptivity with human ACE2 receptivity.

    Now, if I’m right that study and the entire line is going to be memory holed faster then Mao and Israel Epstein’s famine victims. But it’s already been shared and stored so I would advise them not to bother.

    If I’m wrong, can one of the geniuses on this website who are so much smarter then I am, explain exactly the existence of these research lines and samples, in Wuhan.

    Why were the Chinese developing a functional ACE2 pathway using HIV assays for SARs-CoV? Yes, this was in bats.

    But remember – the logic is that it must be an American bioweapon.

    Because

    ‘Targets Asians” due to
    “Asians have more ACE2 proteins”

    Except the Chinese are the ones who have spent years researching the most effective entry of SARS-CoV into ACE2 proteins. And they had recombined it with HIV in 2010.

    And yes, there’s more development, using human recombinants.

    Again – that was in 2010.

    More:

    “The results show that ACE2s of Myotis daubentoni and Rhinolophus sinicus support viral entry mediated by the SARS-CoV S protein, albeit with different efficiency in comparison to that of the human ACE2. Further, the alteration of several key residues either decreased or enhanced bat ACE2 receptor efficiency, as predicted from a structural modeling study of the different bat ACE2 molecules.”

    So the Chinesewere testing the efficiency of SARS-CoV virus via ACE2 protein receptors with human ACE2. As well as bat ACE2.

    That’s confirmed above.

    In 2010.

    So yeah, it’s a bioweapon. Almost certainly a Chinese one. Sure, it’s impossible to say it was one based off ‘this’ exact line. But it’s sure looking like a predecessor isn’t it?

    And it got out of their piece of shit BSL-4 facility, because they built that one based on the stolen materials and piece of shit impressions of one of their agents in Canada who had project oversight on it whilst she was in the Winnipeg facility.

    She almost certainly cheated on whatever piece of shit exam the worthless Canadians proferred her. If they even bother to do so anymore to their Chinese overlords and diversity replacements. Cheating on exams has consequences. Eventually.

    Maybe it got out when they were transferring from that Wuhan 2010 facility to the BSL-4 facility in 2017 late last year. For next stage engineering with western DNA samples they bought off the Jews in Silicon Valley, and from 23 and Me etc.

    Because, if you have minute knowledge of the right inserts to proteins to maximise Virus entry, I’m sure it’s easy to find an insert to target non-Han genomes.

    If they were running HIV recombinant inserts into SARS-CoV in fucking 2010, think how many samples and iterations of HIV + SARS-CoV ACE2 receptor viruses they must have been storing in the Wuhan facility.

    But hold on – the splendid gent who wrote this article said that military research couldn’t possibly happen in a Wuhan BSL-4 facility.

    So how come the Chinese were doing skin-crawlingly dangerous research in 2010, when they didn’t even have a fucking BSL-4 facility in the whole of China in the first place?

    Where were they doing this? In some dog kennel? Where? In a local playgroup kitchen? A BSL-3 facility? But how?

    This is what dual-purpose research looks like. It doesn’t matter the purpose. It matters the methodologies and the related outcomes.

    Having reviewed all of this research line, it’s actually a miracle that this hasn’t happened previously. It keeps getting more and more scary.

    This is why you can’t give stupid peoples toys that are too dangerous for them. Jews and Chinese included. Arrogance and short-term thinking and hubris and messiah complex.

    No doubt all the intrepid intelligence services of the world that serve so assiduously their people will be investigating. The same way Barr is investigating Epstein.

    So this virus or another is going to be burning through western populations very soon. Maybe this really is the end-game.

    Because at best, the only other interpretation is that the Chinese were taking lead on an international affair, mainly working with Jews, and they got betrayed. As Whitney Webb described, it is really weird that there was collaboration taking place between (((US))) and Chinese interests on Chinese soil.

    Then people call it ‘American’. As if Americans with their diabetes and their hypertension and their high cholesterol and obesity could have anything other then blank faced incomprehension to this. We can’t do this, we can’t even build Aircraft Carriers anymore with a working lift for the flying thingymajiggies.

    But for what it’s worth, unless the ‘Americans’ were running a duplicate program to the Chinese program, there is a Chinese program that basically incorporates every datapoint that exists on this virus. HIV, ACE2, Bats and food market, Wuhan, Dual-research, international study of exotic species, espionage, you name it, you’ll find it in these Chinese run studies.

    So basically, we’re probably all going to die. Because there is no way this will only target Asians. No way. ACE2 isn’t Asian only, everyone has ACE2 proteins in some level, and there will be versions that target western genetic nuances. Under the guise of mutation will be a reintroduction, or a novel introduction, probably in revenge by the Chinese.

    But in studying Cao Cao and Bai Ji, it’s targeted revenge that serves best. Or, simply accepting mistakes and endeavouring to ensure they don’t reoccur. That’s saving face. Not destroying the world so no one has any face left to save.

    The most you could say is that if it wasn’t a Chinese accident, it was someone working with the Chinese who betrayed them, and the only names that aren’t Asian seem to be Jewish, Israeli, and/or affiliated to both.

    But why bother. No one is going to read this, or presumably understand it etc etc etc.

    To really bring it home would take too long and be a comment that was too long etc etc. Just read the fucking studies. Everyone here is so high IQ – it should be really easy for you all.

    • Agree: SBaker
    • Disagree: bluedog
    • Replies: @CanSpeccy
  274. @d dan

    True, I am a new poster, but I’m just stating that the government officials silenced the doctors* to keep them quiet about this in the outset or face punishment for “spreading rumors” and “untrue information”. That allowed for massive spread before people even knew there was a problem. This is the same thing they did with SARS. Authoritarian countries’ leadership is highly insecure, and want to control what you know. If they could, they would try to control what you THINK. They try to appear in control, until it’s too late to contain the issue, and are finally forced admit to their own people and other countries things aren’t hunky-dory. China’s secrecy and face-saving tactics allowed this outbreak to become much worse before the international community was made aware of it. Face facts: China LIES. Everyone knows this. Stating facts isn’t hate.

    *here’s a page about one of the first doctors who noticed an alarming new illness similar to SARS showing up, and how police and officials threatened him after he informed peers online about what he was seeing:

    https://www.washingtonpost.com/world/asia_pacific/chinese-doctor-who-tried-to-raise-alarm-on-coronavirus-in-wuhan-dies-from-disease/2020/02/06/8bf305a2-48f9-11ea-8a1f-de1597be6cbc_story.html

    Call hate on THAT.

    • Replies: @d dan
  275. Truth says:
    @thetruth

    Thanks for weighing in, Einstein; and I see Tesla agrees with you. One small quibble:

    Three year olds are generally not considered “babies.”

    • Replies: @Offthepink
  276. Anon[163] • Disclaimer says:

    There’s zero COV19 in my area of the US, but when I went to the store today, the cold medicines had been pillaged. People are prepping already. Buy what you need now, because even 3 weeks from now it may be too late. The supply chain may be going to be seriously disrupted if most people are too sick to work.

  277. @Not-a-Number

    You can take this further. One day they may come up with a, fake or real, deadly communicable disease concentrated in large population centres that will require urgent sterilisation by gamma ray emitting neutron bombs in order to save the rest of the population. Just imagine that, and getting people to accept the need for such action. And you get your Georgia Guidestones depopulation with nary a complaint. Could this event be a stage in preparing for such an event in the future?

  278. CanSpeccy says: • Website
    @d dan

    This commenter CanSpeccy is like a charlatan. He makes comments again and again that have been proved to be false, inaccurate or misleading. e.g. in comment #97 above, he claims that:

    “This is an RNA virus. It has no DNA.”

    Take a look at the official sequence of the virus posted in [1].

    First, you’d do well to study the header to that page which identifies the organism, thus:

    SOURCE      Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
      ORGANISM  Severe acute respiratory syndrome coronavirus 2
                Viruses; Riboviria; Nidovirales; Cornidovirineae; Coronaviridae;
                Orthocoronavirinae; Betacoronavirus; Sarbecovirus.

    See the third line. The virus belongs to the Riboviria, a realm of RNA viruses and viroids.

    DNA sequence data for Covir-19 are translations from the RNA sequence data. The reason for such translation is indicated in this paper, which states:

    The whole-genome sequences of 2019-nCoV from six samples (WH19001, WH19005, WH19002, WH19004, WH19008, and YS8011) were generated by a combination Sanger, Illumina, and Oxford nanopore sequencing. First, viral RNAs were extracted directly from clinical samples with the QIAamp Viral RNA Mini Kit, and then used to synthesise cDNA with the SuperScript III Reverse Transcriptase (ThermoFisher, Waltham, MA, USA) and N6 random primers, followed by second-strand synthesis with DNA Polymerase I, Large (Klenow) Fragment (ThermoFisher). Viral cDNA libraries were prepared with use of the Nextera XT Library Prep Kit (Illumina, San Diego, CA, USA), then purified with Agencourt AMPure XP beads (Beckman Coulter, Brea, CA, USA), followed by quantification with an Invitrogen Qubit 2.0 Fluorometer. The resulting DNA libraries were sequenced on either the MiSeq or iSeq platforms (Illumina) using a 300-cycle reagent kit. About 1·2–5 GB of data were obtained for each sample.

    Anything you don’t understand there, just ask Utu or Ron. They both have incredibly high IQ’s whereas I don’t know much, my doctorate in molecular biology having been obtained a while ago.

    • Replies: @d dan
  279. Anon[163] • Disclaimer says:
    @Pupila

    Bill Gates wouldn’t have wasted so much of his money trying to educate blacks in Africa if he thought it was better to kill them off. He would have set up abortion clinics all over Africa and tried to give this a good face by launching propaganda about serving women’s heath needs. Besides, he is ruled by his wife, and she believes a ton of liberal nonsense.

    Soros, however, is another story. Anyone who is capable of messing with the economies of entire countries just to make a buck, and who has tried to social-engineer entire countries, is definitely a suspect. He’s enough of a sociopath to do it.

    • Replies: @CanSpeccy
  280. Anon[974] • Disclaimer says:

    This is an interesting theory:

    https://lionoftheblogosphere.wordpress.com/2020/02/14/virus-spreading-in-singapore-and-japan/#comment-250849

    There is nothing remarkable here.

    1) The corona virus is a virus designed to target Asians. Since the Chinese like to steal technology, someone in intelligence got the bright idea of making the corona virus available for them to steal. They knew that Charles Lieber (now under arrest) designed the BSL-4 lab in Wuhan and they knew that the Chinese would accelerate development by testing on Chinese prisoners. Because they incubated the virus in Chinese prisoners, the virus adapted to the Chinese male genotype, which has a larger number of ACE2 receptor sites and why it is affecting the male population more than the female population.

    Why couldn’t the Chinese figure out ahead of time that this virus would target them? Those viral features only get activated once exposed to a particular population, said exposure would come about after the Chinese tested the virus on prisoners.

    2) The worldwide economic problems will only benefit the United States, because imports subtract from GDP. As what we import from the rest of the world diminishes, our GDP will go up. That is why the stock market is rising.

    3) What a way to end globalism.

  281. CanSpeccy says: • Website

    The answer to the question of whether the nCorona Virus was a lab escape would be provided by identification of the first victim. Was it a person who worked at the Wuhan lab? Did Li Wenliang identify the first victim, either directly or indirectly? Was Li Wenliang punished for revealing the outbreak of the disease because, in so doing, he threatened to expose a disastrous failure of lab security?

    • Replies: @d dan
  282. It is of grave concern to me that Bill Gates has been repeatedly stating that the coronavirus will soon spread to Africa and could kill millions. He is estimating 10 million deaths worldwide. How will the virus transport itself to Africa and whom will it infect? The Chinese resident there on construction projects? I could be wrong, but Gates’ statements appear rather more like factual revelations from a man who knows something, rather than casual speculation on a worst-basis outcome.

    From everything we know so far, the virus is unlikely to infect Africans, so where will be the source of the 10 million deaths? The virus to date has infected only Chinese and a handful of genetically-similar Japanese. There have been only a few confirmed Caucasian infections, but these were apparently quite mild with the patients being quickly released. To my best knowledge, all the deaths to date have been Chinese.

    I have no answers to the above, but Gates’ pronouncements on this one are beginning to worry me.

    243.Unorthodox Black Sheep VN says:

    “Francis Boyle could be wrong too.”

    Yes. Boyle seemed to make some sense on some topics 15 years ago, but recently he seems to have lost his mind, with conclusions over-reaching facts by a country mile.

    240.Pupila says:

    “George soros owns the lab in Wuhan were deadly virus are studied . . .”

    You need to check your sources before propagating nonsense like this. The lab in Wuhan is part of a local university and is ‘owned’ by the uinversity which is owned by the government. There are no privately-owned universities in China, and Soros doesn’t even own a pharmacy shop anywhere, much less a Level-4 biolab.

    257.utu says:

    “The problem is that all the tracks to the alleged Botao Xiao and Lei Xiao publication lead to Zerohedge but also end there. Zerohedge hyperlinks to ResearchGate are dead. As far as ResearchGate and Google Scholar are concerned this publication does not exist.”

    Yes. Read Ron Unz’ comment 262.

    274.utu says:

    “Or maybe it was discovered to be a forgery, a hoax written by random schmoes using the names of prominent Chinese scientists”.

    Yes, I believe that to be the case.

    264.Offthepink says:

    “The government covered it up and THREATENED doctors who wanted to inform the public…until the truth could no longer be contained. Typical China: lie and deny until it’s impossible to hide, then cooperate in an effort to look like heroes to shut the barn doors after the horses have all escaped…when they themselves could have contained the matter by acting in a timely manner and informing everyone instead of trying to save face and letting things become worse.”

    You have described perfectly the United States of America.

    • Replies: @Parisian Guy
  283. CanSpeccy says: • Website
    @Anon

    Bill Gates wouldn’t have wasted so much of his money trying to educate blacks in Africa if he thought it was better to kill them off.

    But the point of educating Africans is to promote the demographic transition to a society with a below replacement fertility. If that fails, as it appears to be doing, then direct measures might be deemed necessary.

  284. @Wally

    A case in point would be the article on the “moon landing hoax,” which Ron Unz published because he was weary of off-topic moon hoaxers monopolizing intelligent discussions in other articles on the Unz Review.

    Moreover, whenever we’ve published an occasional article having any relation at all to the Space Program, it’s been very irritating that “excitable” Moon Hoax people have frequently cluttered up the comment-threads with their strange ideas. Now that they have this dedicated comment-thread for their extended discussion, it will be much more reasonable in the future to just summarily trash their off-topic comments on other articles.

    —Ron Unz, in the first comment to “The Moon Landing a Giant Hoax for Mankind.”

    I imagine this article on the coronavirus as biological warfare, not even written to the quality of the moon hoax article, might be included for similar reasons. Significantly, the authors of both articles wouldn’t use their real names. That works for commenting, but we should be held to a lesser standard.

    https://www.unz.com/article/the-moon-landing-a-giant-hoax-for-mankind/

  285. @criolle

    Except that they actually did. The whole damn thing was live streamed and I checked in on it daily out of curiosity. When clearing the land I watched 40-50 excavators and bulldozers all working in perfect concert. It was amazing to watch in fact. That is but one contradiction of your nonsense.

    So with that said, I find your claims of qualifications to be highly dubious. In other words, it is you that I do not trust, not the FACT that they did build that hospital in under two weeks.

    TLDR? That is extremely immature.

  286. CanSpeccy says: • Website
    @Anonymous

    Do I have to do a simple goy version for this as well?

    Yeah, why not.
    Sounds important, but this draft is not exactly for beginners.

    • Replies: @Anonymous
  287. @Astuteobservor II

    Profanity is a symptom of a weak mind trying to express itself forcefully. Learn the lingo man!

    • Replies: @Astuteobservor II
  288. Sam J. says:
    @Bert

    “…It doesn’t make sense for U.S.-based actors to do it. A third party actor maybe…”

    The only group this makes sense for is the Jews. The Jews see the Chinese as competition so they want to kill them off like they did the Armenians.

    Oops didn’t mean to hit the agree button for my own post. 🙂

    • Agree: Sam J.
  289. Chinaman says:

    Given all that is going on and that the demographic transition is already happening in China, this might be the perfect opportunity for the Chinese to test USA’s resolve and appetite for a hot conventional war. Let’s lay this coronavirus thing on America and galvanise the Chinese people for war. We need to bring in the Russian of course. Dip our toes in the water by getting involved in Iran and Afghanistan.

    First, let’s agree that nukes are off the table and budget on 200,000 Americans lives and 1 million Chinese for this friendly contest. Honestly, I don’t think Americans have the stomach for it. Once the body counts ramp up, all the snowflakes, LGBT and non-whites will be up in riots knowing they are the cannon fodder and have nothing to gain with a war with China. China is on their side.

    Democracy and diversity makes America weak.

    The Chinese will be asking for MORE since it consolidates their power even further and let them put all that industrial overcapacity and unemployed to good use. A million people isn’t even a round number in terms of the percentage of the population. China won’t even flinch.

    Can America handle 50 million dead? That’s how many Chinese died during the Great Leap Forward. Americans only talk big and flex their muscles.

    Mao said America is a paper tiger. Let’s treat this coronavirus as what it is, as an act of war. Call America’s bluff. If they want a war so much, let’s escalate and bring it on. see who’s the tough guy. I guess it is inevitable at the end.

    The alternative is to let America implode in 20 years when whites become a minority. Not sure what is the best strategy here.

  290. I just hope I don’t get the Corona Light virus.

    • LOL: Alfred
  291. Sam J. says:
    @Old and grumpy

    “…Is the American deep state that good in being a perfectly timed evil?…”

    The American deep State is run by the Jews. Proof positive of this is on 9-11 building 7, owned by the Jews and security provided by the Jews, fell the same speed as if it were held by air[impossible without demo] and not one damn thing has been done about. None of the, so smart, Jews in the Jew controlled media have raised a peep about it except Geraldo Rivera who only did it once.

  292. denk says:
    @CanSpeccy

    You floated that theory…

    its either leaked or deliberately released by the Wuhan lab

    all by yourself.

    Then in desperation you grab at that story from [[[0hedge]]] which turns out to be a dud [courtesy of utu], then you again turn around and claim its your tribute to freedom of expression in China.

    ROFLMAO
    GImme a fucking break !

    What a knotted tongue freak !

    deliberately released

    You’r the ones who crapped these shits on your own people…..239 times [1]
    never mind on the others, Guatamela, Nicaragua, Cuba, France, Korea and……China again and again and again.

    Since doing this kind of stuff comes to you so naturally, hence you and your ilks have no problem projecting your own perversion onto everybody else,.

    [1]
    https://worldtruth.tv/how-the-government-conducted-239-secret-bioweapon-experiments-on-the-american-people/

    I doubt its the full story, most likely a limited handout,
    par for the course//

    • Replies: @CanSpeccy
  293. denk says:
    @utu

    denk a self-assigned troll

    Previously I have reason to call you a troll cuz you keep posting unverifiable youtube vidoes , even from [[[China uncensored]]].
    I’ve revised my view due to your performance in this thread.

    BUt gawd damn it, me a troll ???

  294. CanSpeccy says: • Website
    @utu

    “I had taken the reported existence….” – This was your problem. You assumed the existence. Even some of the Zerohedge commenters seem to be more savvy than you.

    “There is no trace of this paper on ResearchGate now. But it seems it was there 5 days ago”

    This was your problem. You assumed its nonexistence, when it had in fact been there. Perhaps that mean there are some Zero Hedge comments more savvy even than you. But I commend both your diligence and candor.

  295. CanSpeccy says: • Website
    @denk

    Then in desperation you grab at that story from [[[0hedge]]] which turns out to be a dud [courtesy of utu],

    Nothing desperate about it, and as Utu has so honestly admitted, he was mistaken, the story was correct (see #279)..

    You’r the ones who crapped these shits on your own people…..239 times [1]
    never mind on the others, Guatamela, Nicaragua, Cuba, France, Korea and……China again and again and again.

    I’m sorry, but you seem to mistake my identity. My country hasn’t been in nearly so many wars as you seem to think. As for “crapping these shits” on the French, we haven’t done that for over 250 years. In fact during the last century we died in considerable numbers saving the French from German occupation, which was probably a waste of time since being ruled by Germas via the EU seems to be what the the French today want most of all. And, as you must know, we with our allies saved the Chinese from Japanese occupation.

    • Replies: @denk
    , @utu
  296. @CanSpeccy

    Why do you peddle a nothingburger?

    At the bottom of the paper you linked, there is a link to another paper giving the first part of the story. It says:
    “Dr. Frank Plummer, the scientific director of the Winnipeg lab, said the genetic material taken was not the full Ebola virus and does not pose a risk to the public”
    Dr. Plummer would probably be able to tell also the truth about the high-profile Chinese scientist which was fired from the Winnipeg NML lab last year. Allegations of spying and/or virus stealing have been recently released by the current CIA outlets, zerohedge and greatgameindia. No explicit charges have yet been officially released, although the RCMP came to the lab and expelled the Chinese scientist.
    Dr. Plummer died very unexpectedly a few days ago.

    • Replies: @CanSpeccy
    , @Republic
  297. vot tak says:

    A Most Convenient Virus

    https://cluborlov.blogspot.com/2020/02/a-most-convenient-virus.html?m

    The “exceptionals” here take note:

    “First, the Chinese government has treated the epidemic as an act of war, deploying all the means at its disposal, including the military, in order to contain its spread, building several large new hospitals, putting entire huge cities under quarantine and extending the national holidays. The response as been far beyond what this virus seems to warrant, with its low mortality rate. Without saying so, the Chinese government has treated this epidemic as an act of biological warfare—perhaps as a dry run for a more lethal epidemic that may come in the future. At any rate, the Chinese government is seeing to it that nobody can blame it for not taking the problem sufficiently seriously, or not doing enough about it.

    Second, the Western media response has been an exemplary effort to produce a panic and to smear China, making what is happening there into a horror story. Not only did the mass media outlets do their best to stoke mass hysteria about all things Chinese, but various bloggers and independent “experts” pitched in to produce a panic. There seems to have been a policy-driven reorientation from Russophibia (where it has been high time for the US to silently admit defeat and move on) to Sinophobia (where the US is yet to have its ass handed to it on a plate). Those notionally independent commentators who are exploiting this opportunity to attack China are acting as useful idiots in this centrally choreographed media campaign.

    Third, the White House has recently requested that experts look into the possibility that 2019-nCoV has been genetically engineered. It is often the case that the person who shouts “Catch the thief!” the loudest happens to be the thief himself. I suspect that the next move will be to declare that this virus is indeed an engineered biological weapon developed by… why, Russia, of course, and Mr. Putin personally.

    Taking all of this into account, the scenario that seems most plausible to me was that this virus was genetically engineered in one of the Pentagon’s biological weapons laboratories and introduced into China via infected wild bats, having picked the technology and manufacturing mecca of Wuhan as a target. The ultimate goal, one might surmise, is to induce US corporations to repatriate production to the US mainland in order to “make America great again.”

    But my suspicion is that this isn’t going to work. The Chinese government will succeed in stopping the epidemic, in the process demonstrating that it cares about its people and is effective in protecting them. Already the infection rate, plotted on a log scale, is starting to slope down from a straight line, meaning that the epidemic is losing steam. And then, working alongside many other countries, China will move on with the main task of eradicating the other parasite—which is the United States, a country that get something for nothing simply by printing dollars.”

    In the final part quoted above I think Orlov nails it.

    • Thanks: Alfred
    • Replies: @CanSpeccy
  298. @Biff

    Too long a read for my short attention span. Still, I would not put it past a country whose racist doctors used the syphilis microbe to infect its own citizens along with those of Guatemala – and watch the disease run its course, even when treatment was available. I wouldn’t put it past a country whose use of Agent Orange is still affecting newborn Vietnamese babies. I wouldn’t put it past a country whose use of depleted uranium bombs in another country, Iraq, who did absolutely nothing to the US, and whose cancer rates soared after their use in those areas. I wouldn’t put it past the only country ever to have used the atom bomb, not once,
    but twice. All is entirely within the realm of real possibility by our Evil Empire led by cruel and deranged men. We must rank as one of the sickest nations in history.

    • Replies: @Gleimhart Mantooso
  299. d dan says:
    @CanSpeccy

    “See the third line. The virus belongs to the Riboviria, a realm of RNA viruses and viroids.”

    OK. I read it too fast and I was wrong about this. It is indeed an RNA virus, and there is no DNA. My apology to you and the readers.

    • Replies: @CanSpeccy
  300. Anon[163] • Disclaimer says:

    COV19 may be killing people much the same way the 1918 Spanish Flu did. Not long ago I came the claim by a doctor of that period who said people in 1918 weren’t dying of the flu, they were dying of complications of pneumonia. The 1918 flu wasn’t anywhere near as dangerous as people think it is. The problem was, once you were sick, RSV (human respiratory syncytial virus), which is as common as dirt and which causes everything from pneumonia to bronchitis to ear infections, would take the opportunity to invade and spread wildly throughout an already-weakened victim and kill that person.

    Even today, elderly people who are sick in the hospital quite often die of an opportunistic RSV that gives them pneumonia on top of whatever put them in the hospital in the first place.

    Here’s a very revealing scientific paper discussing this in relation to the 1918 pandemic:

    https://wwwnc.cdc.gov/eid/article/14/8/07-1313_article

    We are seeing a lot of the victims in China being labelled as ‘death from pneumonia’ and not by COV19. Westerners are complaining about this, but I think the death by pneumonia designation may be entirely accurate.

  301. @Ayatollah Smith

    How will the virus transport itself to Africa and whom will it infect? The Chinese resident there on construction projects?

    Only one million Chinese people in Africa.

  302. vot tak says:

    “its either leaked or deliberately released by the Wuhan lab”

    The psywar meme that the virus came from a facility in Wuhan was initially pushed by an israeli propagandist. Those continuing to push this psywar are either part of this israeloamerican op or clueless dolts mindlessly repeating the propaganda (monkey see, monkey imitate).

  303. denk says:
    @CanSpeccy

    I’m sorry, but you seem to mistake my identity. My country hasn’t been in nearly so many wars as you seem to think

    NO I didnt mistake your identity.

    Now why’d a canuck appoint himself the official shill for the great satan ???

    https://www.countercurrents.org/miles270507.htm

    • Replies: @Mike P
    , @CanSpeccy
  304. d dan says:
    @CanSpeccy

    “I am sorry, but you are a liar. I said at #248 that and escape from the Wuhan lab was “a plausible hypothesis,” a view supported by the literature reference I gave a 277.

    Poor English may be a plausible excuse for misunderstanding, but it is no justification for the lying accusation that I lied.”

    LOL. You are changing topic yet again.

    My accusation in the immediate preceding comment is about you changing topic, not whether you are offering the paper as proof or as hypothesis of the source of the virus. When confronted with a non-existence paper, you chose to deflect it as lack of freedom in China rather than admitting your mistake.

    Quite a stunt considering your superior English skill.

  305. @Parfois1

    You don’t know very much.

    The prison hospital is prefab modular. This method of building was pioneered and perfected by Americans back in the 60’s. Foreigners routinely expect Americans to be impressed with people doing things that we were doing half a century ago. It’s weird and annoying. Modular construction is yet another innovation of White American genius ripped off by the godless, sociopathic Chinese that dummies like you give them credit for. The same goes for their “major advancements in technology.” Our feckless overlords let them rip us off by allowing them entry into all of our tech sectors.

    I know people who work in biotech, and sometimes they are saddled with having to work with whole teams of these Chinese weirdos. The reputation they have is of being arrogant, stubbornly wrong and oblivious to same, and not terribly competent.

    I personally know an American man and his Chinese wife. They own a business here in the states, but it takes them to China for about half a year also. What I’ve learned from both of them is that the China runs on bribery and paranoia.

    It is fascinating to see people like you here salivating for the Chinese to “pay us back” when it hasn’t even been half established that we did anything. There are counter arguments to this poorly cobbled together mess of an article, but for propagandists like you, it’s too good not to believe. You’re over emotionally invested because you have anti-America bug up your ass, plus which you are apparently a sinophile. The other possibility is that you are a paid Chinese propagandist, which wouldn’t surprise me either.

    The next time you find yourself masturbating to pictures of Tiananmen Square, try and remember that the murdered at least 50 million of their own people in relatively short span of time, and sent many more to re-education camps. They suck, and so do you. Tell your bosses it’s not working.

    • Troll: bluedog
    • Replies: @Alfred
  306. CanSpeccy says: • Website
    @Parisian Guy

    Why do you peddle a nothingburger?

    That’s your mistaken characterization. The question was whether biological material can be taken without authorization from a Level 4 Biohazard lab. Clearly, in that case, it was.

    • Replies: @Parisian Guy
  307. Anonymous[319] • Disclaimer says:
    @CanSpeccy

    Sigh. Fine.

    What’s the core argument? Being colloquial:

    [MORE]

    1: The Basic Argument

    It couldn’t be the Chinese.

    Because the Virus targets Chinese.

    China wouldn’t create a virus that targets Chinese.

    Right?

    1.1 The Evidence

    https://www.biorxiv.org/content/10.1101/2020.01.26.919985v1.full

    This paper says that ACE2 proteins are the receptor for the virus.

    Asians have more ACE2 proteins in their cells.

    Therefore Asians have been targeted.

    There is a very key quote, okay? It says:

    Zhou et. al. conducted virus infectivity studies and showed that ACE2 is essential for 2019-nCov to enter HeLa cells

    So just remember, the Corona Virus uses ACE2 to get into something called HeLa cells.

    1.2 Summary

    The Virus can’t be Chinese made. Why?

    The Virus transmits via ACE2 receptors.

    Asians have more of those.

    The Chinese wouldn’t made a virus that could target Asians.

    Okay?

    2.0 Refutation

    The Chinese actually did make a virus that targets ACE2 cells.

    2.1 The Chinese did isolate an ACE2 Corona Virus. In 2013. The below paper shows it.

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5389864/

    Isolation and characterization of a bat SARS-like coronavirus that uses the ACE2 receptor

    Remember the quote from the above paper? It says:

    2019-nCov uses ACE2 to get into HeLa Cells.

    So look at the 2013 Chinese study:

    “The ACE2 gene was cloned into pCDNA3.1 with KpnI and XhoI, and verified by sequencing. Purified ACE2 plasmids were transfected to HeLa cells

    The Chinese cloned an ACE2 gene and then attached them to HeLa cells.

    That’s exactly what the bR study said is why the Virus targets Asians!!!

    Okay?

    2.11 The bR study findings match the Virus the Corona-Virus the Chinese made in 2013.

    Now look further.

    What’s another features of this virus?

    2019 n-Cov has HIV spikes

    That’s why the Chinese have been treating it with HIV medication.

    That’s what the Indian researchers found.

    So then the argument is.

    China would never add HIV to a Corona Virus that targeted ACE2 which Asians have more of, right?

    So look at this study.

    https://www.ncbi.nlm.nih.gov/pubmed/20567988/

    Angiotensin-converting enzyme 2 (ACE2) proteins of different bat species confer variable susceptibility to SARS-CoV entry.

    The authors are all Chinese and it was undertaken at the Wuhan Institute of Virology. In 2010.

    What does the study say?

    We extended our previous study to ACE2 molecules from seven additional bat species and tested their interactions with human SARS-CoV spike protein using both HIV-based pseudotype and live SARS-CoV infection assays

    Okay?

    I’ll extract it and make it really really easy.

    The Chinese combined ACE2 from bats, with human SARS-CoV spikes and added HIV infection

    The above study shows that the Chinese added HIV spikes to a SARS-CoV virus so it could jump to humans.

    That study is proof that the HIV structures in this Virus were put there by the Chinese.

    2.2 So what’s proof that the Chinese were testing the best way to infect people?

    From the above study, quote:

    ““The results show that ACE2s of Myotis daubentoni and Rhinolophus sinicus support viral entry mediated by the SARS-CoV S protein, albeit with different efficiency in comparison to that of the human ACE2”

    Okay, so to unpack that.

    The Chinese were testing the best ACE2 structure to infect bats and humans with SARS-CoV.

    Is that clear?

    3. Summary

    The cited studies show Chinese in Wuhan doing exactly what everyone says they wouldn’t do.

    The studies show the Chinese

    1. Making an ACE2 SARS-nCoV virus.

    2. Testing the best way to infect humans with a SARS-CoV

    3. Adding HIV structures to a SARS-CoV to make it infect humans and bats better

    Does that make it clear?

    I’m not a microbiologist.

    But look, my IQ basically means no one understands or comprehends me 95% of the time, including rooms full of microbiologists.

    As far as I know, I’m the only person who has cited this line of enquiry.

    But I’m convinced by it.

    This is easily observed, by anyone.

    And I could keep going through subsequent studies that iterated on those previous – they’re all related.

    Because this kind of research is really engineering, subject to the same kind of Schumpeterian process of constant micro-additions.

    So if you keep looking at related research you see more and more additions that match the known data about this present Virus phenomena.

    So is that clear?

    Everything else is circumstantial and supposition.

    This is a smoking gun.

    Then there is this idea that the Chinese couldn’t possibly cut corners or have an accident at an inopportune time.

    But look at that 2010 study where they added HIV infection to a SARs-CoV so that it would better infect humans ACE2 protein pathways.

    There was no BSL-4 facility in the whole of China in 2010.

    So I asked

    where did China add HIV to an incredibly dangerous pathogen in 2010?

    It can’t have been a BSL-4 facility. A BSL-3 facility wouldn’t have the right protections in place, for that kind of incredibly dangerous research.

    So the above papers are also evidence of:

    1. Chinese dual-research.
    2. China cutting corners incredibly dangerously
    3. China breaking or at best only nominally observing international protocols on experimental biological science.

    Given this evidence I think it’s about 85%-90% certain that this Virus is synthentic, and ‘Made in China’.

    I’m being conservative. Because it ‘is’ possible that a similar program existed elsewhere. But there is no evidence of that. There isn’t even circumstantial evidence.

    That could be tested. But I don’t time to do it. The University of Alabama would be a good place to look.

    The other reason for the leeway is China might have had ‘help’ from Jews for this Virus to be released. That would account for all the espionage of the Chinese in the United States (Mr Lieber, Michelle Malkin) and Canada (Winnipeg BSL-4 facility, Ms Giu et al).

    But it’s not ‘America’ that is likely at fault. It will be the Jews and Israelis who worked on the development of this Virus and possibly lied to the Chinese about some aspect of it’s properties and prognoses.

    But the Chinese are insane. They’re insane.

    This is why I said it’s incredible that this kind of tragedy hasn’t happened before in China.

    Had the SARs-CoV-HIV hybrid Virus sample they had in 2010 got out, you might have had very similar consequences.

    So there it is.

    I’ll leave the conclusions to you and others like utu.

    • Troll: vot tak
  308. @Justsaying

    It wasn’t a “country” that did those things.

  309. utu says:
    @CanSpeccy

    “the story was correct” – No, the story was not correct. The fact that the article was vanished changed the whole story. It is the Zerohedge that propagates the story of article that no longer exists. It is Zerohedge that uploads the article to SCRIBD to keep it alive. Zerohedge actually uploads the article to SCRIBD on 2/14 or before while publishing their article on 2/16 with dead hyperlinks that they knew were no longer valid. A possibility that the article was ‘preprint-published’ fraudulently, that somebody assumed the identity of Botao Xiao and his coauthor is likely or it should be considered because we are witnessing a part of the game being played by various agencies that use Zerohedge and you favorite papers Daily Mail, The Sun, Mirror, Express, Daily Telegraph. If you want to be their useful idiot, go ahead, it’s not going be your first, but do not try to drag more people with you.

    • Agree: Biff
    • Replies: @yakushimaru
    , @CanSpeccy
  310. CanSpeccy says: • Website
    @vot tak

    But my suspicion is that this isn’t going to work.

    That is you suspect that your suspicions, which you have acquired by reading someone else’s vacuous blogpost, and which amount to an evidence-free anti-American smear, amount to basically, well, nothing.

    • Troll: vot tak
  311. CanSpeccy says: • Website
    @d dan

    My apology to you and the readers.

    Good grief, D. Dan, you’re a gentleman. Maybe the only one here!

    • Replies: @SZ
  312. Who is Metallicman and what’s his background?

    • Replies: @Hail
    , @Gleimhart Mantooso
  313. d dan says:
    @Offthepink

    “I’m just stating that the government officials silenced the doctors* to keep them quiet about this in the outset or face punishment for “spreading rumors” and “untrue information”. That allowed for massive spread before people even knew there was a problem.”

    I assume you are talking about Dr Li Wenliang, a topic that has been thoroughly discussed in Unz [1] and elsewhere [2]. Just to recap for you: Dr Li was wrong professionally to issue the warning. He did NOT have the expertise to do that. Secondly, if he wanted to help, he should alert the proper authority rather than posting privately to his chat group. What he did was both illegal and didn’t help in the containment. Further, his warning would NOT have helped others because another doctor and the authority were already ahead of him in studying the disease and were in the process to issue public warning. Also, as explained in [2], his message might actually cause panic and more harm if allowed to spread. Finally, Dr Li was not punished. He was issued a warning. The government retracted the reprimand later (although I think the government was correct with the original reprimand).

    [1] https://www.unz.com/article/how-to-yellow-cake-a-tragedy/
    [2]

  314. d dan says:
    @CanSpeccy

    “Did Li Wenliang identify the first victim, either directly or indirectly? Was Li Wenliang punished for revealing the outbreak of the disease because, in so doing, he threatened to expose a disastrous failure of lab security?”

    Wow, another insinuation, even it is posted as questions. No tragedy should be wasted as an opportunity to throw mud.

    Considering how unlikely the proposition is:

    1. Dr Li is an ophthalmologist and lacked the expertise nor the resources to independently research the causes or to identify the first victim. This is also supported by the fact that his original claim was technically wrong (i.e. that it was SARS)

    2. Dr Li’s message and the authority’s reprimand letter both indicated they were not about the source nor the “leak” of the virus.

    3. The only other explanation would be that Dr Li had insider contact. That probability would almost be the same as any random person having the contact, i.e. infinitesimally small.

    4. If Dr Li had insider contact, or other significant info about the “leak”, what was the chance that he would be released on the same day (or be released at all), without further investigation?

    5. If there were indeed other insiders, where were the other arrests?

  315. @Horsehead2020

    My liberal use of profanity is the least of your worries if this shit is true.

    If you are a fellow American, protect yourself. Don’t take chances.

    Some remote suburbs sounds really nice right now.

  316. Sulu says:
    @Anonymous

    The Jews are the people in control of America. If this was done by the American military establishment or by the C.I.A. you can bet it was done with the full knowledge and support of the Jews to accomplish some end of theirs. Some times things that are initially opaque become clear over time. Let’s wait and see what the future tells us about this virus.

  317. Alfred says:
    @Doxocopa

    Your video is part of the war against China. It is by the same people who developed this anti-Chinese virus and released it in China.

    Your comments about the leadership of China are execrable. Unlike in the West, those actually running China are largely technicians and highly-competent people in their respective areas. It is a collegiate effort and Xi is merely their interface with society.

    Just think back to Hurricane Katerina and the obvious incompetence of the US government when faced with any disaster. If this virus were designed to kill off Europeans, the USA would be in a far worse state than China is at present.

    https://www.dosomething.org/us/facts/11-facts-about-hurricane-katrina

    Schadenfreude is a most unpleasant characteristic of US media at present.

    • Replies: @Anonymous
  318. Alfred says:
    @Anon

    Tom Cotton reiterates his suggestion that the Coronavirus originated at a super-lab in Wuhan

    It is good to know that the CIA has a backup for Trump. Just in case he gets a heart attack or anything like that. Alternatively, they can get a Palestinian to shoot him – but that would smack of repetition. 🙂

  319. Anonymous[254] • Disclaimer says:

    I read somewhere that Uyghurs are by far the most susceptible to coronavirus, even more so than Han Chinese, so considering all the concentration camps and oppression China is conducting in Xinjiang it looks most likely that coronavirus was engineered as a bioweapon to commit genocide against Uyghurs, likely created in the Wuhan laboratory, but presumably somehow got released into the local Han population and backfired on them hugely. They likely tried to engineer it specifically to affect Uyghurs as much as possible, but it turned out that other East Asians are not genetically distinct enough from Uyghurs not to also be highly vulnerable to it.

    If this was an American/Western bioweapons attack then I don’t see why China wouldn’t be openly stating this and accusing America/the West of attempted genocide, mass murder, etc. What would they have to lose? Their silence and desperate attempts to cover the whole thing up makes me think that this coronavirus is something of their own making, probably for their own genocidal purposes.

  320. Anonymous[254] • Disclaimer says:
    @wow that was stupid

    Distributing smallpox infected blankets was mostly an American settler enterprise, the native Americans for the most part were pro-British because it was mainly the settlers, the “Americans”, slaughtering them, but of course in American mythology the “Brits” are always the blame for American settler crimes because it’s the most politically convenient and easy option today.

  321. Herald says:
    @Hail

    There comes a time when the huge mounds of circumstantial evidence are so huge, that only fools or the wilfully blind continue to ignore them. We are well past that time.

    • Replies: @Offthepink
  322. Alfred says:
    @Gleimhart Mantooso

    Foreigners routinely expect Americans to be impressed with people doing things that we were doing half a century ago.

    You are entirely correct. I was studying civil engineering in London half a century ago. I spent the summer of 1969 in the USA. I was highly-impressed by the rate at which Americans could put up high-rise steel-framed buildings (not prefabs). I guess the Americans have lost these skills. They are not as smart as they used to be. The influx of cheap labour from south of the border did not help.

    I was taken around by a top engineer at Bechtel’s HQ in San Francisco. They had 23 nuclear power stations under construction. You just cannot compare the USA of that time with the shell that it has become today.

    • Replies: @Anonymous
  323. Herald says:
    @Handle Pseudonymic

    The article was a compilation and also a little bit rough around the edges, but otherwise it was a compelling pice of journalism.

    I suspect that in a previous life you were very likely a deckchair attendant aboard the Titanic.

  324. Just for interest:

    China’s Nankai University announced a breakthrough in developing a novel coronavirus rapid test kit that can identify infection among suspected patients within 15 minutes. The former nucleic acid detection reagents that were used prior, required considerable time and involved some fairly intricate operations, unsuitable for quick testing.

    Tianjin’s Nankai University is gem in China, with a record of surprising breakthroughs in many interesting areas.

    A few years ago, researchers at Nankai developed a car with a working brain-control unit, with sensors that capture brain signals permitting humans to control the automobile with their minds, even to the smallest things like locking the doors and adjusting the mirrors. It was so successful they scaled it up to control a space station, and in 2016 China launched a fully-operational manned space lab to conduct the first ever brain-machine interaction experiments in space. Apparently successful. Can you imagine firing reverse thrusters with your thoughts?

    The researchers said this was the future – the highest form of man-machine interaction. China has developed this process much farther than any Western nation and today holds nearly 100 patents.

    Now, for a good espresso machine.

  325. Mike P says:
    @denk

    Now why’d a canuck appoint himself the official shill for the great satan ???

    It’s called Stockholm syndrome.

    • Agree: denk
    • Replies: @denk
  326. SBaker says:

    A diatribe filled with asinine statements is unworthy of publication at this site or any other. I would expect this kind of nonsense to come from some 4th world nation in another hemisphere.

  327. Anonymous[157] • Disclaimer says:
    @Alfred

    Americans as a whole are not racially the same people in 2020 that they were in 1969, not by a considerable margin, so it’s not at all surprising they’re less smart and not as skilled as they used to be, it’s to be expected actually.

    I notice that white Americans seem to be becoming increasingly frustrated with America’s poor performance compared to decades gone by because most of them refuse to see race as an issue, so they are just bemused as to what is going on, they can’t really explain it.

  328. Larry Romanoff is entirely untrustworthy, so anything derived from what he has said or written has to be viewed with extreme scepticism. Romanoff is a throughly deceitful Iosef Vissarionovitch Dzhugashvili (“Stalin”— ‘Man of Steel’) apologist, so everything of which he accuses the US is precisely what the Communists in China are guilty of inflicting on their own citizenry.

  329. anon[837] • Disclaimer says:

    The coronavirus was created by the Chinese themselves to genocide the Uyghur people. It backfired on them and now Han Chinese are dying from it. Too bad chinks, being evil gets you bad results…

    • Troll: d dan
  330. @clickkid

    Great story. I really mean that.
    One question though, what about Mr. Washington’s demented adopted son: Little Izzy?

  331. @utu

    On top of that, read the article. It is not a technical one. It basically says that Chinese scientists are researching SARS for obvious and easily understandable and justifiable reasons. Then there is a brilliant young scientist who studies bats, again, also for the usual reasons that biologists study animals. After that, the article points to the 270 meter distance from the lab to the market. Then nothing. There is no new information, no previously publicly unknown information. The reasoning, if we can say that, is no more than the level of rumoring. At this point, as being pointed out, we should doubt if the authorship is totally fake.

    • Replies: @utu
  332. @Chinaman

    I believe that is probably a very common opinion at the top of the PLA and the MInStateSecurity and the top of the Party.
    Act now or be cautious and wait.
    Or, cut out the middleman, support Iran in attacking Israel.

  333. @Anonymous

    Nobody would believe them and they would be ridiculed in all western media, thus losing face. Besides, after having accused the US what could they do next? Declare war on the US?

  334. CanSpeccy says: • Website
    @utu

    “the story was correct” – No, the story was not correct. The fact that the article was vanished changed the whole story.

    It was correct as far as any reader could discern at the time it was published. The fact that the abstract to the article to which the story referred subsequently disappeared from ResearchGate is anothe matter.

    What you have is a different story, which is that ZH referred to what you take to be a fake article that was subsequently removed from the Web, although not from the Way Back Machine.

    But so what? Who, beside a super high IQ genius like you or Denk, cares? We know Internet news is mostly incorrect, lies or fantasy. I’m not going to waste my life worrying whether the report of some mundane opinion was a real person’s real opinion or merely the figment of a journalist’s imagination. That’s the trouble with you high IQ types, you obsess about trivialities.

    What’s relevant is that the real or fake article by the real of fake Botao Xiao stated that COVIR19 was probably an escape from the Wuhan Level 4 Biohazard Lab. But that was a mere opinion, an opinion that conforms with the conclusion drawn by others with relevant expertise, as I have indicated above.

    In any case, whether COVIR19 was an escape from the Wuhan lab, that lab possessed that virus or similar agents, which suggests they should have an antidote or vaccine, or at least be in a position to produce a vaccine soon. Or so one might judge from news reports (if they haven’t already been disappeared overnight).

    For example, Inovio, an American company says it has already “designed” a corona virus vaccine.  Moreover, there is said to be a rush to produce a vaccine not only in China and the US but also in Britain, where a group at Imperial College, London is claiming to have a vaccine ready for animal testing now. Now prove that that’s all lies and I’d be interested.

  335. No idea if this is a bioweapon, but if Tel Aviv Tom is taking the lead on US agit-prop, then there HAS TO BE an Israeli angle.

    https://moderndiplomacy.eu/2018/04/25/tom-cotton-whats-the-reason-for-aipacs-4-5-million-support-for-the-young-senator/

  336. CanSpeccy says: • Website
    @denk

    The Red Guards out in force today. Even Gentleman D. Dan. Gives a faint indication of what it was like to be a petty land owner confronted by the village mob during the Cultural Revolution.

    • Troll: d dan
    • Replies: @Offthepink
  337. denk says:
    @Mike P

    Here’s Speccy shilling for US exceptionalism..

    That’s not how realpolitik works. Rights don’t come into it. Power is the determining factor, and China is Hell-bent on outflanking the US as both an industrial and military power.

    https://www.unz.com/wwebb/bats-gene-editing-and-bioweapons-recent-darpa-experiments-raise-concerns-amid-coronavirus-outbreak/#comment-3705604

  338. Ko says:
    @Naill

    Perhaps we have different teaching styles. (Though I don’t look at it as luck.)

    Then again, meeting for brief periods and spending ten hours per week for a semester would naturally yield different relationships. And I suppose the reasons we face the students matters. Keep in mind, I’m not saying they have open discussions in class and express themselves freely. Quite the opposite. But, in small groups, individually, they all know they are not free and yes, they hate it.

  339. Ko says:

    @Ber – are you saying you are a Troll?

  340. Republic says:
    @Parisian Guy

    Yes,Dr Plummer died of a “cold,” a few days ago in Kenya

  341. utu says:
    @yakushimaru

    Correct. The article in itself did not provide any new information but apparently was needed to support the desired narrative and that’s why its appearance served as an excuse for the avalanche of the MSM Chinese-did-it narrative.

    Within a narrow window of time all British tabloids Daily Mail, The Sun, Mirror, Express, Daily Telegraph and Zerohedge blasted the same message that the case is closed, Chinese did it, and we know it because the Chinese said so themselves. While broadcasting the Chinese-did-it message the alleged publication itself was long gone and nobody in the MSM or in Zerohedge addressed this fact.

    • Replies: @Ron Unz
  342. @Herald

    “There is hardly any reasonable doubt that the corona virus was bioengineered. ”

    Make that “hardly any evidence of bioengineering”. All it takes is an out of date article by some cut&paste addicted loon to bring out the ‘tards on this site.

    • Replies: @Herald
  343. Ron Unz says:
    @utu

    Within a narrow window of time all British tabloids Daily Mail, The Sun, Mirror, Express, Daily Telegraph and Zerohedge blasted the same message that the case is closed, Chinese did it, and we know it because the Chinese said so themselves. While broadcasting the Chinese-did-it message the alleged publication itself was long gone and nobody in the MSM or in Zerohedge addressed this fact.

    Exactly. This whole pattern seems suspiciously like some aspects of the 9/11 attacks or the Iraqi WMD claims, e.g. that Arab hijacker passport that mysteriously survived the WTC attack.

    Obviously, none of this proves that Coronavirus is actually a biowarfare attack against China, but I do think it tends to shift the likelihood somewhat in that direction…

    • Agree: utu, Herald
    • Replies: @CanSpeccy
  344. @Franklin Ryckaert

    True, but another possibility is that the US and Chinese are reading from the same script (as the US, Iranians, and probably Russians were last month).

  345. Anonymous[257] • Disclaimer says:
    @Alfred

    Hurricane Katrina was just another hurricane and was handled in the standard manner. It was the pro black anti White lying press that lied about the response and handling.

    It was the black mayor and local government that handled things so badly in New Orleans. The hurricane was equally bad from Alabama to Texas. But the lying press concentrated on New Orleans black government dis function and blamed it personally on President Bush. That’s like blaming some substandard food purchased in your local supermarket on the CEO of Kroger that owns about half the supermarkets in the country.

    Here’s just 2 examples of city of New Orleans affirmative action black dis function .

    1 the other cities began evacuation on Friday. Labor Day weekend being one of the biggest weekend for bar club restaurant receipts , the black mayor ordered evacuation to begin Tuesday. The hurricane had already hit by Tuesday. That mayor went to prison later fro various malfeasance and embezzlement. The New Orleans affirmative action black police in uniform, on duty ignored their jobs and looted stores in uniform. There are hundreds of videos of this.

    2 New Orleans had 800 school buses all gassed up and ready to work on the Tuesday the first day of school. Those buses stayed in the parking lot.

    Every other city and town from Alabama to Texas used school buses and city buses to evacuate residents who didn’t have cars. New Orleans city buses sat in the parking lot as well. The other Gulf coast towns have used city and school buses for hurricane evacuation since buses the first buses were bought.

    I used to work for a city. I found in my desk an old 1950s evacuation manual for emergencies. It detailed an entire procedure for the bus system to send buses to pick up points to pick up people to take them out of town. The rest of us were supposed to go around directing people to go to the pick up points. I remembered that during the Nee Orleans fiasco.

    You don’t believe what the lying press writes about the epidemic. But you believe what the lying press wrote about New Orleans and Katrina? You should have read about how Mobile, Biloxi, Galveston local authorities handled Katrina efficiently and swiftly according to the procedures they’ve used since those towns were founded.

    So you believe the lying press.

    • Replies: @Truth
  346. d dan says:
    @Anonymous

    “I read somewhere that Uyghurs are by far the most susceptible to coronavirus, even more so than Han Chinese”

    I challenge you to provide proof or link for that assertion. Otherwise, you are likely another CIA sponsored troll spreading misinformation.

    Considering there are only 75 people infected and 1 death in Xinjiang as of Feb 18 (and probably about half of these 75 are Han, because Han takes up substantial population in the province), you are unlikely to find sufficient data or study to conclude that.

    “If this was an American/Western bioweapons attack then I don’t see why China wouldn’t be openly stating this and accusing America/the West of attempted genocide, mass murder, etc.”

    Maybe Chinese scientists have more urgent things to do, like saving lives, research cure and vaccine, or tracing the source of the virus? Or may be because they are still gathering evidence. Or may be they are considering what should be the appropriate response, etc.

    “Their silence and desperate attempts to cover the whole thing up makes me think that this coronavirus is something of their own making, probably for their own genocidal purposes.”

    Given the above possible reasons I stated, no, their silence does not imply the conclusion that you wish people to believe.

    • Agree: Alfred
  347. @Franklin Ryckaert

    Believe or not, at that point, yes, their only choice is war.

    What kinda country would China be if their population centers are getting attack by bio WMD and do nothing about it?

    This all hinges on this american bio weapon conjecture being true.

    • Replies: @Offthepink
  348. Alfred says:
    @Anonymous

    considering all the concentration camps and oppression China is conducting in Xinjiang

    Repeating the lies of the mainstream media gives the game away. Why does the mainstream media never have articles about the real concentration camp on the Mediterranean? Gaza is a concentration camp and they don’t even have supplies of potable water.

    Would you care to compare the fictive “concentration camps” in Xinjiang with Gaza? Do its putative occupants get water to drink? Or do they have to buy it at high cost per liter from the Israelis?

    China is well aware that the West is using Uyghurs as mercenaries in Syria. The intention is clearly to send them back to China to foment trouble. Terrorism.

    AP Exclusive: Uighurs fighting in Syria take aim at China

    Clearly, if the West were not trying to encourage sedition in Xinjiang, there would be no need to “re-educate” Uyghurs. It is a direct response to attacks by the West.

    • Agree: Commentator Mike
  349. You fail to understand that the world has no nations, its the illusion you were taught to believe. Its time to start thinking without flags, they mean nothing to powerful psychos

  350. “MY HERITAGE” / DNA UTAH ? / USA
    A present was offered to my friend. It came from a relative working in big corporate environment. The stuff was about “knowing your origins”. She had to do a biological removal with a small stick or something like that in the internal part of her cheek for DNA. Then she returned it to the sender in the US about one year ago then received the results (and a surprise “you got a far cousin living nearby”). After reading the Unz tribune and thread of comments about some chinese enraged about US DNA collectors I asked her the adress. The society name : “My heritage”. It was in “UT” (Utah I suppose ?) . It was written “Lehi” and “Israël” in the adress, “parkway (…) etc.) . DNA collection for some underhanded purpose ?
    A link Mormon – Zio (Utah ) ? Mormon loves genealogy…which is close to genetic. They write the list of the “chosen ones”
    When you see the treator Romney trying to please the neocons… It’s another topic, but well….hmm

  351. CanSpeccy says: • Website
    @Ron Unz

    Obviously, none of this proves that Coronavirus is actually a biowarfare attack against China, but I do think it tends to shift the likelihood somewhat in that direction…

    Ha! according to the big brains the “likelihood” has shifted “somewhat in [the] direction,” of the COVIR-19 epidemic being “actually a biowarfare attack against China.”

    What is this likelihood-shifting evidence? Just that the British tabloids best known for endless bullshit have raised the obvious possibility — a possibility well supported by expert opinion published in the peer-reviewd literature — that the COVIR-19 was an escape from the Wuhan lab, which we know was working with bats and corona viruses.

    In fact, the most probably interpretation is that the Wuhan Level 4 Biohazard lab was, at least among other things, researching biowarfare agents that might be used against China, the work being conducted with a view to identifying antidotes or vaccines (for precisely the same reason Britain, France, Russia, the US, Canada have Biohazard labs doing similar work). And if that is what the Wuhan lab was doing, then naturally they would have been working with agents to which the Chinese people are particularly susceptible. Equally naturally, this would have exposed the public to the risk of the escape of a dangerous pathogen. Hence, we can assume that contingency plans existed to deal with such an escape. Moreover, the radical steps that the Government of China has taken to deal with the current epidemic supports that assumption.

    The validity of those assumptions are in no way diminished by the existence of a real of fake Chinese journal article preprint asserting the obvious possibility that the COVIR-19 epidemic resulted from an escape from the Wuhan lab.

    An obvious route for virus escape is by way of an accidentally infected lab worker. However, such reports as I have seen do not suggest that the first person known to have been infected was a lab worker.

    Another possibility, is a biowarfare attack on China by, presumably, the US. But other than the existence or non-existence of a paper expressing an opinion about a lab escape (which I would certainly not describe as evidence of the proposition in question), there seems to be no scrap of evidence in support of this idea (yes, yes, we know that there were Americans in Wuhan at the time of the first infection, but while that inflames the minds of anti-American Chi-Comms and American fellow travellers, it is not evidence of anything other than the fact that there were Americans in Wuhan for entirely legitimate reasons.)

    The conclusion seems obvious: no one at Unz.com has a clue about the origins of the COVIR-19 outbreak, although most seem to have an axe to grind, hoping it seems, that this event will launch WWIII.

    • Replies: @Republic
    , @Milton
  352. @Ayatollah Smith

    “All I did was sleuth though public, but forgotten articles, and stung things together into a thesis.”

    What you did was to plagiarise articles on this subject, mostly from Larry Romanoff’s articles published on Global Research.

    And string [or “sting’] them together with a lot of incoherent blabbering. The stream of consciousness approach to epidemiology.

    The author seems to be a little confused about the meaning of the term “thesis.” But at least he’s willing to admit this:

    I do not have all the answers.

    Understatement of the year.

    • Replies: @Anon
  353. Agent76 says:
    @Unorthodox Black Sheep VN

    I read and listen to anything that does not violate my moral standards. I have been reading and viewing the news globally since 1990.

    “Small is the number of people who see with their eyes and think with their minds.” Albert Einstein

  354. Republic says:
    @CanSpeccy

    https://jameslyonsweiler.com/2020/01/30/on-the-origins-of-the-2019-ncov-virus-wuhan-china/

    On the Origins of the 2019-ncov-virus wuhan, china

    He reviews four options on the origins of 2019 virus

    option 1
    natural coronavirus related to bat coronaviruses, not a recombined virus

    option 2

    A recombined virus that naturally picked up a SARS like spike protein in it N terminus (3’end) of the
    viral genome

    option 3

    A recombined virus made in a laboratory for the purpose of creating a bioweapon

    option 4

    A recombined virus made in a laboratory for the purpose of creating a vaccine

    He concluded: in the worse case scenario, if the vaccination strain is more highly contagious
    and lethal, 2019-nCoV could become the worse example of vaccine derived contagious disease in human history

    • Replies: @CanSpeccy
  355. @Truth

    Times, they are a-changing. These days, 20 year olds are considered “children”.

  356. @Anonymous

    Ok, I messed up on the parties involved. But it HAPPENED. Nitpicking doesn’t eliminate the fact that it took place.

  357. @Herald

    No, red shills would rather go through all kinds of mental gymnastics, like saying America snuck in and released something that only China is working on, at one of the few labs where they are working on it, rather than the FAR more probable somebody screwed up and it got loose.

    Also, found this

    Dr. Sechun Lin of the US Army Medical Research Center also reported that the sequencing of 2 essential parts of the virus genome showed no anti-virus shift from the original bat genome. In his experience this lack of genetic mutations from one species to another is extremely unlikely to happen naturally and is more typical of genetically modified laboratory strains of a virus.

    • Agree: Hail
  358. Anonymous[340] • Disclaimer says:

    This reads like a ranting CCP apologist.

    The fact that there is a Chinese bio weapons lab in Wuhan, which had access to and was doing active research in, various coronavirus specimens is telling. Not proof in and of itself, but telling. Occam’s razor – the Chinese are lax with disease treatment in humans and animals alike. The Chinese are lax with hygiene and sanitation. The Chinese are lax with safety standards and medical ethics. It’s far more likely this has a start with a Chinese screw up than anywhere else.

    The fact that multiple outbreaks occur across time and space inside one country should be a clue towards a systemic problem within the host country.

    The comparison to the most recent outbreak of swine flu is silly. Swine flu is easily traced to the farms and transmission points. The swine industry in China is concentrated and contaminated feed (often made of or in contact with destroyed pigs) helped ensure the spread of that. They simply do not practice “good” industrial farming technique. Combine that with a low education rural populace and you have the seeds of disaster.

    Could it be muh evil Americans launching bio warfare? Maybe. But nothing in this screed does anything to actually explains direct linkage or plausible delivery mechanism.

    More likely this is Chinese incompetence on various levels.

    • Agree: Republic
    • Replies: @clickkid
    , @Parisian Guy
  359. Milton says:
    @CanSpeccy

    14 days after the “American in Wuhan for entirely legitimate reasons” leave, the virus first shows up. The incubation for the virus is 14 days. A coinkydink, I’m sure.

    The problem with Team Neocon is that they are filled with hubris and stupidity in equal measure. They might have got away with playing chicken with Russia over Ukraine, but I can’t see China not responding in kind to this obvious case of covert Neocon bioterrorism.

    • Replies: @utu
    , @CanSpeccy
  360. utu says:
    @Milton

    “…I can’t see China not responding…” – Maybe but I doubt it. I do not think they have means for perpetrating a perfect false flag that only the recipients of it would understand the message being sent. Like for example Ivanka catching incurable case of acne on her face or Don Jr. having a hunting accident.

    Most importantly the CCP leadership wants to preserve peace and harmony in China thus they will not instigate outrage, anger and cries for revenge among their citizens and thus any conspiracy talk and insinuations that America did it will be suppressed in China because CCP’s lack of response would make them look weak in the eyes of their citizens. They may even pay CanSpeccy to explain to the less politically savvy Chinese that it was just an accident. There will be a meta-stable equilibrium between two players: “I know that you know” and “I know that you know that I know” who for now do not want to escalate but at some point China could stop pretending it is raining when somebody is pissing on them but then their response would be overt and crude which would lead to war. I think China will not make the same mistake as Japan made in 1941 because time is on their side.

    • Agree: Parfois1
    • Replies: @Commentator Mike
  361. clickkid says:

    It’s highly unlikely that we, the public, will ever definitively have proof that this was an attack by the US government, its agents or proxies, on China. Certainly nothing that could be expected to hold up in any court of law. Courts of law – quite rightly – demand very solid evidence before someone is convicted. The government of China – and perhaps other states – will perhaps be able to gather enough evidence to be able to take a position on the cause of the epidemic, and may come to the conclusion that this was an attack

    In our personal lives we often have to make decisions, often the most important decisions, without any definitive proof that what we are doing or thinking is correct. We have to make a judgement call based on the balance of probabilities, or use our intuition (our gut feeling), which really means that we are using an unconscious process to weigh up the evidence that we do have.

    Here is a list of factors which I think should be taken into account in deciding (based on imperfect knowledge) whether this was an attack by the USA on China for geopolitical advantage.

    Does the virus show signs of being an artificial product?

    If different scientists have different views on this, is that a reflection of the scientists’ source of income?

    Does the virus show signs of being ethnospecific or at least affecting East Asians much more than others?

    If you were planning a viral attack on China, what time of year would you choose?

    Was there foreknowledge? Was that Turkish tweet from 11th June 2019 just a stupid coincidence?

    Would US agencies technically be able to do this? Have they been researching biowarfare for decades?

    Is there evidence that US agencies have used bioweapons in the past?

    Does the expenditure of resources in research not imply that one would be ready to use the results of that research?

    Does not the PNAC Statement on ethnically specific bioweapons imply that powerful individuals within the US Establishment are ready to use such a weapon?

    Is it possible to use such a weapon with a great deal of plausible deniability?

    If so, would this tend to increase the likelihood of use – ie one wouldn’t be caught?

    The first-level reason for the outbreak was the ‘wet market hypothesis’. The second-level reason for ‘prying minds’ was the possibility of a viral leak from the Wuhan lab. Who has been pushing the
    Wuhan lab theory and are there signs that this was prepared in advance?

    What importance do we attach to the apparent collection of Chinese (and Russian) DNA by US institutions?

    What importance do we attach to the apparent fact that there are many US military biolabs scattered around the world?

    What do we suppose that they do in these biolabs?

    Is there evidence from behaviour or prior statements that the ruling clique in the US considers that its power, wealth, influence etc is threatened by the continuing industrial development of China?

    In history do ruling cliques try as much as possible to maintain their power?

    Has the US sought to frustrate China’s projects with other states -Belt and Road?

    If so, how successful was the US in this?

    If the US ruling clique has not so far been successful at containing China with the methods it has used, does that not imply that it must either try other methods or eventually cede a large part of its global power?

    Are there signs that there has been a propaganda preparation for this attack? This would include stories run in the media to demonize China etc.

    Have there been signs of a propaganda offensive since the outbreak began?

    What is the tone of coverage in the western press Re, China?

    When judging an individual we often consider past form. If we look at the military and foreign policy of the US since 1947 – particularly 1991 – do we get the sense that this is organization that considers itself constrained by laws, international norms and the sovereignty of other states?

    If we assume that the US ruling clique wishes to weaken China relative to the US, then how successful has the outbreak so far been? Has it damaged China’s economy or its reputation?

    Last year saw the refounding of the Committee on the Present Danger (China) by a number of prominent individuals in the US.

    https://presentdangerchina.org/

    This organization considers the rise of China to be a danger to the US. How do they propose to stop it?

  362. clickkid says:
    @Anonymous

    Food Standards:

    “Insect-filled chocolates, rat hair-infested noodles, and orange juice containing maggots are just some of the “horrors” UK consumers could be forced to accept if post-Brexit Britain signs a wide-ranging trade deal with the USA.

    In the US, producers adhere to a “Defects Levels Handbook,” which sets out the maximum number of foreign bodies like maggots, insect fragments and mould that can be in food products before they are put on the market.

    For example, US producers are allowed to include up to 30 insect fragments in a 100g jar of peanut butter; as well as 11 rodent hairs in a 25g container of paprika; or 3mg of mammalian excreta (typically rat or mouse excrement) per each pound of ginger.

    In the EU there are no allowable limits for foreign bodies in food products.”

    https://www.independent.co.uk/news/uk/home-news/food-standards-brexit-uk-us-trade-deal-maggots-rat-hair-worms-insects-mould-products-a8575721.html

    • Replies: @Anonymous
  363. Parfois1 says:
    @Anonymous

    If this was an American/Western bioweapons attack then I don’t see why China wouldn’t be openly stating this and accusing America/the West of attempted genocide, mass murder

    Perhaps because the Chinese government has not got an iron-clad proof, which may be extremely hard to obtain. And because they are not used to bare-face lying like the US criminal political elites, they are holding their judgement for the time being.

    Meanwhile, who are known to have an extensive track record of using biological weapons? Here is a primer on the subject:

    https://www.globalresearch.ca/the-geopolitical-deployment-of-biological-weapons/5703005

    And don’t try to hide the criminals behind the “American/Western”. This is an “American” modus operandi – sneaky cowardly criminal acts.

  364. @CanSpeccy

    You are dreaming when you try to cover your first lie by means of two additional lies.
    Here is what you actually said:
    “Here’s an example of a deadly virus being simply walked out of Canada’s Level 4 Biohazard lab:

    To which I answered you peddled a nothingburger, because there was no deadly virus: from your own reference, it appeared that the lab director testified:
    the genetic material taken […]does not pose a risk to the public

    You just answered by two lies:
    1) The question was whether biological material can be taken without authorization
    Definitely not. I answered to your “deadly virus” claim, by which you falsely tried to support this other claim to Ron Unz: “if a lab has is working with a biowarfare agent, then that agent can escape, rather easily it would seem in the case of the Canadian lab,
    Therefore you’d told about “biowarfare agent” and “deadly virus”.
    Once it was clear that your own reference involved only “genetic material” without any risk, you pretend your claims were precisely about this kind of stuff , not the deadly one.
    2) Naturally, you need one additional lie, and you charge myself of your fault by shamelessly telling I was the one who used mistaken characterization

    • Troll: CanSpeccy
  365. CanSpeccy says: • Website
    @Republic

    Re: James Lyons-Weiler hypothesies

    Yes, all of the options mentioned are more plausible than the crackpot conspiracy theory based on vacuous assumptions that America just launched a (failed) WMD first strike against China.

    • Replies: @Anon
    , @Alfred
  366. CanSpeccy says: • Website
    @Milton

    The incubation for the virus is 14 days.

    When its not some other length of time up to 90 days, by some reports.

  367. Parfois1 says:
    @clickkid

    Another excellent step-by-step presentation of the questions the investigative mind would consider to solve a crime – and an extension of the usual “who dit it?” (Motive, Means, Opportunity, Connection). I would also add the MO (Modus Operandi) and precedent.

    The answers to all those questions inevitably raise a pointed finger at the US criminal government and ruling elites – the only critters who can compete with the Zionists in malevolence and criminality.

    • Thanks: clickkid
  368. @clickkid

    In my opinion this is was an attack on China to weaken China economically and an indirect attack on Iran which exports oil to China, and the zionists are behind this attack.

  369. CanSpeccy says: • Website
    @clickkid

    It’s highly unlikely that we, the public, will ever definitively have proof that this was an attack by the US government, its agents or proxies, on China.

    Exactly. So claims that this was a US WMD attack on China are no more nor less than evidence-free conspiracy theories. Such claims are apparently acceptable to the big brains, Utu and Ron (was it the latter who gold-rimmed you splendid conspiracy theory endorsement?). If so it seems to prove the point that IQ has little to do with general intelligence.

    We have to make a judgement call based on the balance of probabilities, or use our intuition (our gut feeling), which really means that we are using an unconscious process to weigh up the evidence that we do have.

    So you means the Chinese are gonna go to war with us based on gut feel, unless of course their gut feels are different from yours. God, you make the world seem a truly scary place.

    Here is a list of factors which I think should be taken into account in deciding (based on imperfect knowledge) whether this was an attack by the USA on China for geopolitical advantage.

    Does the virus show signs of being an artificial product?

    What’s that got to do with whether this was a WMD attack on China by the US? This is imbecility. Modifying viruses is what WMD labs do, as much for defensive reasons as offensive.

    Does the virus show signs of being ethnospecific or at least affecting East Asians much more than others?

    So what if does? Isn’t that what East Asians have to defend against, viruses with ethnospecificity for East Asians.

    Blah, blah, blah … What do we suppose that they do in these biolabs?

    What do you think the Chinese, the Brits, the Russians, the Canadians do in theirs?

    Do you teach kindergarten, or what?

    In history do ruling cliques try as much as possible to maintain their power?

    Oh come on. Why not ask: Is it true that God is love? But no, apparently you think you can extract proof of the launch of WWIII from a viral outbreak that has killed 0.001% of China’s population and at worst might kill, what? 0.01%, 0.1, 1.0%. Even 10 percent would make little difference to China’s econonomic strength. Indeed it might add to it.

    This organization considers the rise of China to be a danger to the US. How do they propose to stop it?

    Well any developing nation is a potential threat to the US which is obviously rotten to the core and sinking fast. But attacking someone else ain’t the intelligent solution. The solution is to be better than the other guys. That’s what the US was during the Cold War. And if the US cannot rise to the challenge now, then its finished whatever happens in the short term. Going to war with China will simply make the collapse of the US Empire that much more unpleasant for all concerned.

    • Replies: @Parfois1
  370. @CanSpeccy

    You’re not joking. I don’t know when China became so trustworthy that people would blame other countries and imaginary jews (racist whites and arabs always seem to rear their ugly heads every time some international issue occurs) for something obviously homegrown in the middle kingdom.

    • Replies: @CanSpeccy
  371. Truth says:
    @Anonymous

    It was the black mayor and local government that handled things so badly in New Orleans. The hurricane was equally bad from Alabama to Texas.

    That is purely moronic, how many metropolitan areas of over a million people are there on the coast outside of New Orleans? 80% of a major US City was underwater, and A US Mayor has no auspices to make people leave their homes. Louisiana is not Beijing.

    But the lying press concentrated on New Orleans black government dis function and blamed it personally on President Bush.

    Here are the effects of your “equally bad hurricane.”

    • The vast majority of the fatalities — an estimated 80 percent — came from the New Orleans metropolitan area

    • 1,464 deaths in Louisiana from Katrina (LA Dept of Health)

    • Mississippi suffered greatly as well, with 238 fatalities (MS Dept of Health)

    • 14 deaths in Florida (CDC, March 2006)

    • 2 deaths in Alabama

    • 2 deaths in Georgia from Katrina

    https://www.foxnews.com/story/fox-facts-hurricane-katrina-damage

    But the lying press concentrated on New Orleans black government dis function and blamed it personally on President Bush.

    Well why wouldn’t they? The POTUS had proven himself to be a liar and an incompetent fool for the first 6 years of his reign.

  372. Anonymous[228] • Disclaimer says:
    @clickkid

    https://www.embopress.org/doi/10.1038/sj.emboj.7600640

    Receptor and viral determinants of SARS‐coronavirus adaptation to human ACE2

    This paper contains more evidence of China engineering ACE2 pathways for maximal SARS-CoV infection.

    [MORE]

    “Two regions of the S‐protein‐binding site on ACE2, and two residues in the RBD of these S proteins, largely determine these differences.”

    “Our data describe S‐protein adaptations, and their receptor counterparts, that permit efficient infection of human cells.”

    The Chinese isolated the S-Protein spikes from bat SARS COV that maximise human infection.

    They were comparing one SARS strain to another, and determining what made one more virulent compared to the other.

    Sounds innocent, but later:

    The Chinese added HIV infection spikes to the ACE2 receptors

    And you, just pretend that those papers don’t exist, and everyone is so stupid that they can’t go and read them.

    So you say one of the factors that support an attack on China by the United States is:

    Does the virus show signs of being ethnospecific or at least affecting East Asians much more than others?

    Well yes, it does. Why?

    Because the Chinese engineered their SARS-CoV Virus samples for maximum infection via the ACE2 receptor pathway.

    There are literally dozens of papers all of which show the progression. They may be innocent in and of themselves. However, the samples engineered within them are not so innocent.

    In the above paper, the Chinese mixed human and rat ACE2 to identify what protein residues in what zones allow efficient infection. i.e.

    “These data indicate that differences in the ability of rat and human ACE2 to support infection are localized to the catalytic domain of the receptor.

    The Chinese knew, must have known, the entire time, that Asians have higher ACE2 then non-Asians. But they proceeded with their dual purpose research nonetheless.

    So you can pretend those studies don’t exist, or effect not to understand them – that’s fine. You do that.

    But do not lie, and act as if the nCoV-19 targeting higher East Asian ACE2 receptors is the fault of the United States. Because on that point, there is overwhelming evidence that it is the fault of the Chinese.

    There are literally dozens of studies showing the Chinese spent YEARS understanding how to infect humans with SARS-CoV via the ACE2 receptor.

    “Does the virus show signs of being an artificial product?”

    Not just signs – you can literally see the features of this Virus like it’s infusion into HeLa Cells in the Chinese studies – they engineered it to do that. Just click on the links. ACE2, HeLa Cells.

    Yes – it looks like a Chinese product, based on the available evidence. It’s not conclusive, as I said. But it’s pretty strong evidence, and it looks stronger if commentators on this event just willfully and deceitfully pretend it doesn’t exist at all.

    “If different scientists have different views on this, is that a reflection of the scientists’ source of income?”

    You don’t need to be a Scientist. If you aren’t a dunce, you can just READ THE CHINESE PAPERS.

    What importance do we attach to the apparent collection of Chinese (and Russian) DNA by US institutions?

    What importance do we attach to the collection of western DNA by Chinese institutions, in collusion with western private enterprises like Facebook and Google? Or via hacking of US government institutions?

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6556182/

    Quote “Medical records of at least 173 million of people, gathered since Oct 2009, have been breached and might have adversely influenced over half of the population in the USA.”

    Do Department of Health and Human Services records and corrections departments include DNA digital samples? The answer is yes. Who hacked them? The CIA? They already have it. Who does that leave?

    Well the City of London Corporation probably has them. Israel will. But is anyone really so stupid as to think China doesn’t have those samples? Israel probably gave them the samples.

    In history do ruling cliques try as much as possible to maintain their power?

    Yes – that’s why Xi had killed or imprisoned or bankrupted 1.3million Chinese as of 2017. And it’s ongoing. But you say China is a politically united Utopia, and it’s so pathetic and ridiculous a and insultingly stupid that it’s risible. Yes, the magnificent Soviet union has sufficient grain in the Ukraine to maintain the health and wellbeing of all the regions Kulaks and peasants comrade. They’ve all just taken a nice holiday in the Urals. Gone East comrade.

    “Is there evidence from behaviour or prior statements that the ruling clique in the US considers that its power, wealth, influence etc is threatened by the continuing industrial development of China?”

    Yes – just like there is evidence from the ruling clique in China that it considers that Chinese power, wealth and influence is threatened by industrial re-development of the United States, and of nations like Japan. In fact there is evidence that the radical cadre that rules China thinks the United States constitutes future lebensraum. So why pretend that doesn’t exist? If you were more even-handed, it wouldn’t piss people off into responding to your white-washing.

    “Are there signs that there has been a propaganda preparation for this attack? This would include stories run in the media to demonize China etc.”

    You mean the TRUE stories about China putting millions of Uyghurs in concentration camps and then arranging for the forced rape/marriage of their wives to ugly bug eyed bugmen? Yes, that’s happened. And the true stories about Chinese sabotage and espionage and thefts all over the western hemisphere? Yes, that’s happened.

    What’s the difference between a Uyghur Muslims and a White European Christian in terms of consistency with Chinese social-religio fiat? Tell us tell us tell us.

    Or the true stories that Chinese cheat and steal from western universities at rates that are incomprehensible to anyone who isn’t Jewish or an affirmative action waste? Yes, that’s happened.

    “It’s not just the gaokao – it’s the SAT, the GRE, and a whole host of other exams. An estimated 90 per cent of all recommendation letters for Chinese applicants to United States universities are fake. Some 70 per cent of application essays are not written by students, and 50 per cent of grades transcripts are falsified.”

    90% recommendation letters are fake

    70% of application essays are not written by students

    50% of grades transcripts are falsified.

    Oh wait – that was actually reported in CHINA. The Chinese engaged in virulent anti-Chinese propaganda.

    So if cheating is so rife in China, why does everyone keep telling me how brilliant these cheating Chinese are? They aren’t brilliant. That’s precisely why they’re developing AI to do the work for them.

    Does it mean the US are good? No, the Jews who rule the United States and their adjacent Oligarchs are guilty of the most profoundly obscene crimes. Sins that cry out for vegeance. Against their own people. This website has covered some of them in relation to Jeffrey Epstein and Pizzagate (which was entirely real). And in many ways, China is superior and even morally cleaner. But not by much.

    https://www.nbcnews.com/news/world/china-forcefully-harvests-organs-detainees-tribunal-concludes-n1018646

    It’s always pretty funny when Chinese apologists say that African Americans get imprisoned a lot in the United States. Yes, because they commit most of the crime. But also, the United States doesn’t harvest their organs while they’re alive.

    Was there foreknowledge? Was that Turkish tweet from 11th June 2019 just a stupid coincidence?

    How do you know that it wasn’t foreknowledge of some internal Chinese plot? Seriously? China have had these SARS-CoV-HIV Virus samples since 2010.

    They created the 2010 sample when they didn’t have a BSL-4 facility in China. That means they created a deadly virus sample without commensurate protections. Is it really far-fetched to believe that there could have been an accident? Like there was with the original SARS breakout where they fired Li-Liming head of the Beijing Institute of Virology and confirmed it? It was a tiny outbreak, but it was a classic breakdown in bio-science protocols.

    If the virus is from the United States (which lets assume is being used as substitute for ‘Israel’) – why won’t the Chinese just prove it internationally?

    I’m not even saying you don’t have good points. The timing ‘is’ suspicious on it’s face, and it would look strange for Asians to be more at risk without having access to the papers that show the Chinese developed Viruses to effect maximum risk for people with higher levels of ACE2 receptors.

    But no one has answered why you would infect not just a national transport hub, but an international transport hub, with a virus that can mutate and incubate asympotamatically for weeks? That’s pretty relevant. Cases are going to explode in the coming weeks all over the West. Seems kind of stupid doesn’t it? To infect your own people?

    Just be more even-handed. If someone takes the trouble to present information that is unique, cogent and some might even say brilliant, don’t just ignore it. Account for it.

    Otherwise, all the accusations you level at ‘American propaganda’ look like they’re projections.

    If you keep lying about the ‘Targets Asians’ lie, you are going to look very silly.

    • Replies: @anonymous
  373. CanSpeccy says: • Website
    @Offthepink

    I don’t know when China became so trustworthy that people would blame other countries and imaginary jews

    Yeah, its nuts. Who knows what happened? No one here has any evidence to make a determination. Therefore, why are people so insistent on US guilt?

    Yes, the US may have made a clandestine WMD attack on China. The US apparently engaged in sabotage against the Soviet Union, so may be doing so now against China. And are they responsible for the locusts headed China’s way too?

    But while some folks have brought scraps of information to the table, there’s nothing here that would allow a reasonable determination of responsibility.

    And now this headline:

    Apple warns on revenue guidance due to production delays, weak demand in China because of coronavirus.

    So even if China was the target, the US economy may yet be the biggest loser.

  374. The Zionist neocons have committed some very heinous crimes, I think everyone can agree on that. There is definitely a strain of megalomania, psychopathy and outright lunacy on display in many of these creeps. If they were going to do this, they would have to have the explanation available that if it really is shown to be a biological attack, then the Chinese did it to themselves. Of course they’d rather have in people’s minds the image of filthy wild animals being eaten, but to answer the suspicion of biological attack, they must put the blame on the Chinese government. Of course that isn’t proof. But every time someone like Tom Cotton opens his mouth, one is immediately tempted to think of the worst possible interpretation of his words, because that is how a person with experience of such people reacts to psychopaths.

  375. @Anonymous

    The fact that there is a Chinese bio weapons lab in Wuhan

    Where’s is your evidence it’s a bio weapons lab?

    • Replies: @Anonymous
  376. @Agent76

    I think you should be wary on China Uncensored, the channel also use the tactic “mix truth with lies” or “cut this add that” to trick to people to believe them. They are the employees of Falun Gong, I will said into simple way that from my own experience with the people who practice Falun Gong in my country Vietnam that Falun Gong is a very healthy body exercises but it cannot treat the serious diseases like cancer. Li Hongzhi, the founder of Falun Gong, is in fact a heresy, blasphemy when he spew nonsense about Buddhism like “he is better and powerful than Jesus” or some thing like that.

    They also have Vietsub Channel with the name “Trung Quốc Không Kiểm Duyệt” and the channel know the Vietnamese hatred to China and the channel have tricked or brainwashed many Vietnamese especially when majority of Vietnamese does not have critical thinking skills or does not have any knowledge on Zionism.

    Trung Quốc Không Kiểm Duyệt
    https://www.youtube.com/user/TQKoKiemDuyet

    I also don’t believe China is an anti-imperialism country or good guy, China is a imperialism country from my own observation and story from last generations but I don’t let the Sinophobia mindset cloud my judgement. I will say that to people: China Talk Is Not China Action.

    I don’t trust China has any good intention especially their imperialism action in South China Sea.

    I also believe the saying of Malcolm X: I am for truth, no matter who tells it.

  377. Parfois1 says:
    @CanSpeccy

    Well any developing nation is a potential threat to the US which is obviously rotten to the core and sinking fast. But attacking someone else ain’t the intelligent solution. The solution is to be better than the other guys. That’s what the US was during the Cold War.

    If that’s the best thing you can say to exculpate the criminal Uncle Sham, you really have lived under a rock for donkeys. By saying that attacking other countries is not an intelligent solution you are implying that Uncle Sham is intelligent and would not do such dastardly acts as attacking other countries! Wow! What has he (and his fathers) been doing for ever since the first invasion in 1630: attacking other countries.

    Or that Uncle Sham is not intelligent, therefore his attacking other countries is justified for not being intelligent. Yes, insanity can be pleaded in a court of law to avoid legal responsibility, but in that case the accused is confined in a mental institution for life or until recovery for a lesser offence. Similarly, a rabbid dog is put down. But the crime has been committed and cannot be erased.

    To crown it all: “The solution is to be better… That’s what the US was during the Cold War”. Wow! That’s straight from the other ((sister-state-in-crime))’s copybook: “We are the most moral state”!!!

  378. I am not a fan of China or socialism/communism at all but I must say I have to commend the Chinese response to this viral emergency. Some of their action were a bit heavy-handed when people did not cooperate but you can get away with things like that in a Socialist dictatorship. Even though they were a little bullying in places it seems to me most of their plans and responses were carried out as painless as possible. The Chinese are saying that this emergency could be an act of aggression by “someone” but they could be covering the fact that they ‘dropped a test tube somewhere’. They also could be telling the truth and if they are then there will be a retaliation somewhere down the line. The Chinese are an old civilization and are in no hurry to get ‘even’ as long as the get even. They have patience. We must have resolve.

  379. Anonymous[303] • Disclaimer says:

    I find it hard to argue at this point that it wasn’t a biological agent. We can argue from where it originated, but the key is what China thinks.

    They can easily cook up their own virus that targets white people in retaliation. There will be the same level of plausible deniability.

    And I doubt the Wests ability to contain an outbreak.

  380. Anonymous[303] • Disclaimer says:

    I am curious to hear some of the Chinese posters here talk of what the Chinese people think.

    Are there Chinese forums and comment boards where they are asking the same questions?

  381. @Astuteobservor II

    How about “DUH, a smaller populace is easier to more fully control”?

    • Replies: @Astuteobservor II
  382. Anon[348] • Disclaimer says:
    @James Forrestal

    In retrospect, it was probably not the best idea to put an Institute of Virology in such a large population center.

    The series of events that happened the past few days made me even more suspicious that this is indeed a bioweapon attack on China from ZUSA/Israel. All the following occured in the last 4 days with headlines on the WSJ:

    1) US charging Huawei with RICO, a charge usually reserved for organized crime
    2) Pompeo attending a conference in Europe and telling the Euro leaders “The West is winning against China”. The next day Defense Secretary Mark Esper gave the same speech to the Euro leaders and urged them to help the US contain China.
    3) Yesterday, Trump said he’s planning to curb sale of GE’s jet engines to China
    4) Today, US says will require firms that make products with more than 10% parts from US to stop selling parts incl. chips to Huawei and ZTE

    What will happen tomorrow? It seems everyday they try to put a new curb on China. Meanwhile, Zerohedge is increasingly belligerent in their headlines, multiple articles daily relentlessly attacking Chinese government, accusing them of lying, accidental leaking of bioweapon, fudging coronavirus numbers, fudging economic data, losing control, 4.4 million will die from coronavirus (a couple of days ago it was 30 million), today an article straight up asks if China’s government can survive. It’s almost shocking. I’ve never seen this kind of concerted effort to try to tear down a government, they are kicking China as hard as possible while they’re down.

    Pompeo, Pence, and the rest of the Ziocon satanic tribe are panicking. Trump gives them the best chance of taking down the China-Iran-Russia alliance. Belt & Road could totally isolate Israel and US. UK & Germany are completely ignoring Trump’s call to ban Huawei. Bernie could well get elected. If that happens, it’s the end of their New World Order with Jerusalem as world capital.

    • Agree: utu
  383. anonymous[340] • Disclaimer says:
    @Anonymous

    The Chinese knew, must have known, the entire time, that Asians have higher ACE2 then non-Asians.

    Do you know this or are you just speculating? Looking into the connection between ACE2 receptors and East Asians I found this article:

    https://www.eturbonews.com/542533/coronavirus-risk-for-asians-africans-caucasians-revealed/

    A comparison between eight individual samples demonstrated that the Asian male one has an extremely large number of ACE2-expressing cells in the lung. This is based on an unfinished study by Yu Zhao, Zixian Zhao, Yujia Wang, Yueqing Zhou, Yu Ma, Wei Zuo and published by Bio Rxiv :

    The study they reference is this one from January 26 of this year.

    https://www.biorxiv.org/content/10.1101/2020.01.26.919985v1.full

    I do not know of any previous studies talking about racial differences in ACE2 receptors.

    WIV has been playing around with the ability of coronaviruses to use ACE2 receptors to infect humans (including using HIV pseudoviruses and amino acid segment inserts from SARS-CoV) at least since 2007 from what I have seen.

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2258702/

    I presume they were studying mostly just ACE2 receptors in Chinese people? If that is the case, and the racial differences in ACE2 receptors hadn’t been reported on yet, then it is possible they were unaware of these differences while doing all of these studies.

    • Replies: @Anonymous
  384. Neutrino says: • Website
    @Anonymous

    The worldwide deep State Illuminati apparently doesn’t give a rat’s ass about China,Russia,America or Tembuckfuckingtoo .

    RE: Georgia Guidestones “maintain world population under 500 million.
    (What happened to 6 billion people?)

    RE: The Masonic religion should be, by all of us initiates of the high degrees, maintained in the purity of the Luciferan Doctrine.
    Albert Pike – Morals and Dogma

  385. Anon[332] • Disclaimer says:
    @CanSpeccy

    Yes, all of the options mentioned are more plausible than the crackpot conspiracy theory based on vacuous assumptions that America just launched a (failed) WMD first strike against China.

    If it was indeed an American attack, I don’t see how it could be considered a failure rather than a resounding success.

    It’s not a conventional military attack like a missile whose success is defined by how much immediate material destruction it causes. It’s unconventional warfare, like with sanctions and embargoes, designed to inflict economic and political damage. Its success or failure has to be considered on those terms.

    The Trump administration has been very open about its policy aims with respect to China for 3 years now: to reduce trade with China, to get allies and neutral countries to reduce their trade with China, to move supply chains out of China and into either factories in the US or US allies, to hamper Chinese trade initiatives like the Belt and Road, to isolate China economically.

    From the viewpoint of the Trump administration, this is either great luck or the result of a maneuver designed to further its foreign policy goals.

    • Replies: @CanSpeccy
  386. CanSpeccy says:
    @Anon

    Meanwhile, Zerohedge is increasingly belligerent in their headlines, multiple articles daily relentlessly attacking Chinese government, accusing them of lying, accidental leaking of bioweapon, fudging coronavirus numbers, fudging economic data, losing control, 4.4 million will die from coronavirus (a couple of days ago it was 30 million), …

    Wrong there. You changed projected infections to deaths, resulting a 1o- to 100-fold error:

    When people’s chances of becoming infected vary, an outbreak is more likely to be eventually contained (by tracing contacts and isolating cases); it might reach a cumulative 550,000 cases in Wuhan, Allard and his colleagues concluded. If everyone has the same chance, as with flu (absent vaccination), the probability of containment is significantly lower and could reach 4.4 million there.

    As for the 30 million “a couple of days ago” do you have a reference for that? It doesn’t come up in a Google search. .

    And concerning:

    US charging Huawei with RICO, a charge usually reserved for organized crime

    Have you considered that there could be a basis for the charge?

    In February 2003, Cisco Systems sued Huawei Technologies for allegedly infringing on its patents and illegally copying source code used in its routers and switches.[3] According to a statement by Cisco, by July 2004 Huawei removed the contested code, manuals and command-line interfaces and the case was subsequently settled out of court.[4] As part of the settlement Huawei admitted that it had copied some of Cisco’s router software.

    In a company blog post Cisco’s Mark Chandler stated that the settled case had included allegations of “direct, verbatim copying of our source code, to say nothing of our command line interface, our help screens, our copyrighted manuals and other elements of our products” by Huawei. Prior to Cisco providing conclusive proof in 2012 the story of Huawei’s blatant plagiarism had obtained the status of folklore within the routing and switching community.

    and much more at Wikipedia and elsewhere.

    • Replies: @Anon
  387. Neutrino says:

    Behold I make all things new. (Jesus)

  388. Truth says:

    The end is nigh, Gentlemen. The “Coronavirus is God’s judgement, whether it came from bats, pangolins, Trump, or Xi, that’s all inconsequential now.

    Find the Most High and repent. And do it soon.

    https://www.godlikeproductions.com/forum1/message4269279/pg1?c1=1&c2=1&disclaimer=Continue

  389. CanSpeccy says: • Website
    @Anon

    The Trump administration has been very open about its policy aims with respect to China for 3 years now: to reduce trade with China, to get allies and neutral countries to reduce their trade with China, to move supply chains out of China and into either factories in the US or US allies, to hamper Chinese trade initiatives like the Belt and Road, to isolate China economically.

    Well obviously. Trump was elected on an platform of economic nationalism, which means getting back jobs so profitably outsourced to the sweatshops of Asia by the likes of IBM, Microsoft, Apple, etc. So, yes, he wants to get jobs back the America, and failing that, to transfer American business to allies rather than rivals, China being the first among rivals. You don’t like that? Why not?

    From the viewpoint of the Trump administration, this is either great luck or the result of a maneuver designed to further its foreign policy goals.

    My bet is that from the point of view of this time next year, the covid19 epidemic will look like a blip on the political landscape. But if it is not a blip on the political landscape, then it will likely have unpleasant repercussions for America and the rest of the world. Already American companies are being hit by supply constraints that are slowing sales and adversely affecting profits. Meantime the drop in Chinese oil demand is affecting the US oil industry that depends on high prices to remain solvent.

  390. Anon[348] • Disclaimer says:
    @CanSpeccy

    Definition of Racketeering: Racketeering refers to crimes committed through extortion or coercion. A racketeer attempts to obtain money or property from another person, usually through intimidation or force.

    The RICO Act focuses specifically on racketeering and allows the leaders of a syndicate to be tried for the crimes they ordered others to do or assisted them in doing, closing a perceived loophole that allowed a person who instructed someone else to, for example, murder, to be exempt from the trial because they did not actually commit the crime personally.

    So they are essentially labeling Huawei a criminal organization, so they can pin a racketeering charge on the Huawei CEO who was arrested and is now fighting extradition treaty in Canada. But what exactly is the crime?

    Copyright infringement happens all the time, even btwn US firms. No one’s ever been charged with RICO and sent to jail for it. It’s always a civil suit with monetary compensation. This has nothing to do with Cisco. It has to do with Huawei selling technology to Iran and refusing to stop when pressed by Pompeo.

    Zerohedge hysteria — it was actually 5 billion to be infected, killing 100m, not 30 million. This website is absolutely the worst fearmonger on the internet and Ziocon’s #1 propaganda machine to bring down CCP:
    https://www.zerohedge.com/geopolitical/shocking-admission-who-advisor-says-coronavirus-may-infect-over-5-billion-people

  391. @Offthepink

    This wasn’t even a long comment chain, just two.

    You can’t even follow a two comments long conversation?

  392. Anonymous[539] • Disclaimer says:

    Does the Tokyo 2020 Olympics logo remind you of anything?

    [MORE]

  393. If_No_Facts [AKA "Or_Is_This_Just_Another_Hoax"] says:
    @Ayatollah Smith

    Okay, so … based on stuff like…
    a. the music-enhanced video clips of what look so obviously like unskilled actors pretending to suddenly die (of the virus) right there on a public street, and
    b. the simultaneous claims that the virus bomb was dropped in early November AND that its incubation period is 14 days AND that it was diabolically timed to start on the most sacred holiday (January 26), and
    c. the reports of instantaneous superhuman recordbreaking public-health responses (prior planning and preparation???),
    etc. etc. etc. …

    [MORE]

    …based on the long list of stuff like that, here’s another theory: that this could be yet another media-propagated fiction.

    Would it not be possible… is it not worth considering the possibility that… a news story could be invented — about an enemy country committing unthinkable acts of terrifying inhumanity that threatens the lives of everyone on the planet — as a strategy to vilify said enemy around the world, and weaken/defeat said enemy, and maybe deal with said enemy doing things like economic sanctions, arresting CFOs, fighting over territory (So. China Sea), encouraging internal dissent (Hong Kong, Taiwan…), etc.?

    So many completely fictitious “news” stories. The game of “benevolent leaders” (who are actually controllers of large militaries that maintain a wealth-status-quo) fooling the masses of gullible believers has been going on from time immemorial.

    Is the current corona-virus story another hoax? Is this long, repetitive, dubious, anonymously-authored blog part of it?

    I have no idea. Just posing the question.

    p.s. I know scientists have been bio-engineering deadly creations for decades in the U.S., but the U.S. is definitely not the only place. (Cloning in China, for just one country-example, has been calmly reported for many years; and it’s no secret they, and many other countries, have genetic engineering labs like Genentech; etc.)

  394. @utu

    utu,

    There is nothing to stop some individual or group of Chinese bioengineering a DIY revenge attack, or undertaking some sabotage activities in the West without the consent or help of the PRC government. I’d say that Canada should be first on their list given how they kidnapped a Huawei CEO on behalf of USA and a Canadian lab may have been involved in producing this virus (the talk that some Chinese stole it could be just disinformation to hide the reality that they gave it to CIA agents infiltrated in the US military attending the games in Wuhan). OK, we’re all speculating here but there is no reason that some Chinese may not believe some of these true or false more or less far-fetched speculations and act. And they won’t act like Arab terrorists; they’re far more subtle, and there could be many disgruntled Chinese in senior or minor positions in the West willing to undertake something – just about anything. The options are endless.

    • Replies: @utu
  395. utu says:
    @clickkid

    Both the Left and the Right are in agreement on China. Here George Soros’s two cents:

    Europe Must Recognize China for What It Is (Feb 11, 2020)
    https://www.project-syndicate.org/commentary/china-huawei-threat-to-european-values-by-george-soros-2020-02

    Only the Chinese political leadership can decide Xi’s future. The harm caused by his mishandling of the coronavirus outbreak has become so visible that the Chinese public, and even the Politburo, must recognize it. The EU should not knowingly facilitate his political survival.

    • Replies: @CanSpeccy
    , @Ron Unz
  396. Anonymous[319] • Disclaimer says:
    @anonymous

    Do you know this or are you just speculating? Looking into the connection between ACE2 receptors and East Asians I found this article:

    It’s educated speculation.

    It goes back further then 2007. It probably goes back decades.

    But there are studies from the midst of the first SARS outbreak in 2002-2003 all which look at ACE2 receptors, S-protein’s and related residues, and human/animal gene engineering in Wuhan.

    https://www.biorxiv.org/content/10.1101/2020.01.26.919985v1.full

    Yes that is the bR study I refer to above.

    [MORE]

    That’s the study where the Chinese (Zhou et al) found in a specimen of the 2019 n-Cov that ACE2 is essential for it to enter HeLa cells.

    HeLa cells are the oldest immortal cell line that biologists use to experiment with. They are immortal, and don’t die after a certain number of divisions.

    What was really interesting is that I found that in an earlier Chinese study:

    ““The ACE2 gene was cloned into pCDNA3.1 with KpnI and XhoI, and verified by sequencing. Purified ACE2 plasmids were transfected to HeLa cells“.

    So the Chinese are on record as exactly using ACE2 to basically infect human HeLa cells.

    So the bR authors can’t have known about that Wuhan study, because it didn’t include a ‘Zhou’.

    That’s interesting in and of itself. They basically did an independent paper that didn’t look at precedent papers. I don’t know why.

    But yes, the bR paper says:

    We… noticed that the only Asian donor (male) has a much higher ACE2-expressing cell ratio than white and African American donors (2.50% vs. 0.47% of all cells).

    This might explain the observation that the new Coronavirus pandemic and previous SARS-Cov pandemic are concentrated in the Asian area.

    So that’s actually the only current theoretical evidence for why people are saying nCoV2019 targets Asians.

    But then this paper just got published on January 24, 2020 – even though the actual study was conducted in 2004.

    It says:

    “We therefore conclude that although ACE2 serves functionally as the receptor for entry of the SARS coronavirus into human host cells, the evidence provided by this study does not support an association between its common genetic variants and SARS susceptibility or outcome.

    Despite its X-chromosome location, poor outcomes in male SARS patients do not appear to be related to genetic variants of ACE2.”

    But then they also said this:

    All of the individuals studied were unrelated individuals of Chinese ethnicity

    Which means it was a ‘within-Chinese’ sample – set.

    You know what I think?

    The Chinese are lying to their people.

    They’re trying to pretend that within-species studies can refute the bR between-species study.

    So I think we’re still back to bR.

    That above study just says that ‘within-Chinese’ ACE2 gene polymorphism doesn’t impact death-rate.

    Gene polymorphism is just where a gene takes on multiple different forms. So they’re saying that whatever the form of the ACE2 gene, within Chinese samples, it won’t effect your vulnerability to SARS.

    But I think we’re still back at bR for ‘between-Chinese’ and other ethnicities for ACE2.

    The only reason the Chinese would publish a 2004 study in January 2020 would be to mislead their people about the effect of their Virus on Asian genetics.

    The Chinese absolutely would have known about ethnic differences in ACE2 cell distributions.

    They’ve been studying ACE2 virus infection for almost 15 years.

    There are studies on Cardiovascular disease and hypertension that talk about ethnic differences, but not in any direct way probably due to politics.

    https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2258702/

    So looking at your study, it’s yet another instance of the Chinese engineering genes so that human cells could be infected by SARS-CoV via the ACE2 pathway.

    Nice find.

    Here is the key description:

    Fourth, a minimal insert region (amino acids 310 to 518) was found to be sufficient to convert the SL-CoV S from non-ACE2 binding to human ACE2 binding, indicating that the SL-CoV S is largely compatible with SARS-CoV S protein both in structure and in function.

    – Before that they said they couldn’t get the SL-CoV to infect their chimera samples. Then they added those amino acids 310 to 518 to the ACE2 receptor.

    – That enabled the SL-CoV they were using as a proxy for SARS-CoV to infect the human HeLa cell via the ACE2.

    So this whole time, the Chinese have been trying to find out the best way to infect humans with SARs-CoV via the ACE2 they have more of.

    That’s the conclusion in literally study, after study, after study from the Wuhan Institute of Virology.

    And once again – All of these studies before 2017 weren’t taking place in a BSL-4 facility with appropriate protections.

    If any single any one of these Chimera Viruses they created got out and was live, it could have caused the same tragedy and crisis.

    You know what’s even more dangerous?

    They were using HeLa cells!

    HeLa cells are immortal!

    That’s the point. HeLa cells just re-form themselves at the point of cell death.

    Well fucking great. So we have a Chinese SARs-CoV-HIV virus based in an immortal cell line that doesn’t die of it’s own accord.

    Surely, surely these people added some structure to denature the HeLa cells so they wouldn’t be immortal. Surely. Surely. Surely.

    If China didn’t, they are so screwed, and so are we.

    HeLa cells are notorious for invading other cells. So imagine a HeLa cell, carrying a Virus optimised for maximal human infection. Look at the Wikipedia for HeLa cells.

    For fucks sakes. This is why you need a BSL-4 facility where you destroy these Chimera samples or denature them before you do ANYTHING else.

    I mean, this is like a macabre tragi-comedy that ends in apocalypse. Every single time you look at what they were doing it just gets worse, and worse, and worse.

    I presume they were studying mostly just ACE2 receptors in Chinese people? If that is the case, and the racial differences in ACE2 receptors hadn’t been reported on yet, then it is possible they were unaware of these differences while doing all of these studies.

    Yeah that appears to be the case.

    I’m going to readjust the probabilities.

    It’s now over 90% certain that this really was a Chinese virus. Probably even 95%.

    The only question now is if some Jew who was working with them decided that the Chinese are a threat to the Jews.

    There is no fucking way an American would release a HeLa SARS-CoV-HIV virus into the wild, even if it goes through an ACE2 pathway Asians have more of.

    Because Europeans still have ACE2 receptors, and more then enough to receive a virus.

    And I understand that this virus makes men infertile.

    So here is a prediction – the virus if we can ever get a live sample is going to have aspects of all these different aspects we’ve examined.

    Alongside the HIV spikes it may have those Amino acids 310 to 518 – that could be tested.

    And it may have the properties of HeLa cells.

    If all of this is true – the Chinese have to let the international community examine the virus.

    This goes well beyond politics. This is insane. We can’t have this thing in the wild.

    And if it’s an RNA-Virus as has been established in this thread that supports the theory that it can act as a bateria-phage and act as a virus that infects bacteria and archaea.

    The only way to get rid of a HeLa virus with RNA bacteria properties is basically to nuke every city it’s found in, both above ground and under ground.

    I’m not kidding.

    So don’t let that extrapolation undermine the more conservative speculation however.

    But unlike the ‘Americans attacked China’ speculation – this isn’t really speculation this is literally like watching a building site.

    The Chinese built this virus. If not, they absolutely built precursors, and they’ve been building them for years.

    So I don’t want to hear any more shit about ‘Targets Asians’. Because if it does ‘Targets Asians’ it’s because the Chinese decided to ‘Targets Asians’.

    • Replies: @anonymous
  397. Anonymous[303] • Disclaimer says:

    “I am curious to hear some of the Chinese posters here talk of what the Chinese people think. Are there Chinese forums and comment boards where they are asking the same questions?”

    Yes. Several major forums and platforms, and millions of Chinese already asking the same questions. So much so that the government has publicly addressed the issue directly, and politely asked people to not speculate because it doesn’t help.

    The options are few. If the Chinese government believes (or even has proof) the US unleashed this virus on them, and they make that information public, what is the result? 1.5 billion Chinese screaming to nuke the US? That would be a good way to build hate for the US and obtain public support for a world war, but China doesn’t want a world war and, in that context, would then be seen as weak.

    Few of you may be aware of this, (and yes this is relevant even if it annoys you that I communicate by analogies). Many years ago there was something, at least in the comic books we read, called “The Cowboy Code”, a sort of catalogue of honor with admonitions like “Never shoot first; Never hit a smaller man”. I don’t know if it was ever followed by real cowboys, but it was a useful moral list for young boys.

    There was a second list that was more like a “Cowboy’s lessons in living”. Most was humorous, with admonitions to “Always drink upstream from the herd”, or “Don’t squat with your spurs on.”

    But I recall one very useful piece of advice in that list: “Never corner anything meaner than you.”

    The American political/war machine is the second-meanest sonofabitch in the valley. Proceed with caution.

    • Agree: utu
  398. Wonderful says:

    Ah yes, the CIA funded millions of Hong Kong citizens to protest, seems legit!

    Also, it is noteworthy that you didn’t mention the numerous cases of black bagging of journalists, there even was a doctor warning the public over the corona virus quite some time ago, when China claimed it was nothing to worry about, he, and many others “mysteriously” vanished. China has done all it can to shut down facts from leaking, and has gone after any country that issued a travel ban.

    To compare China with its citizen monitoring to the original USA is ridiculous. There is obviously no constitution and freedom of speech, people are given points based on how obedient they are to the government, with a bad score leading to inability to use trains, banks, rent homes and so on.

    We will see if this is a bioattack based on how hard other countries will be hit. To begin with, it seems more likely to have been an initiative by non-governmental actors such as Bill Gates/others and deep state operators. To say the US launched it implies something else.

  399. 394. Anon[348] • Disclaimer says:

    “I’ve never seen this kind of concerted effort to try to tear down a government, they are kicking China as hard as possible while they’re down.”

    It happens in your country all the time. You need only connect the dots. Whenever your hidden state wants to prepare the Western Christian nations to launch a war on someone (as the Banker’s Private Army), or otherwise destroy them, they first demonise the intended victim, using their media power to daily paint said victim as the eipitome of evil – or the Axis of Evil. By the time they are finished, the millions of brainless Americans, Canadians, Brits, Aussies, are raging for war. Or, at least, don’t mind when that country is demolished.

    This was what happened in the US prior to both World Wars – a years-long diatribe (thanks to Lippman and Bernays, and to the Tavistock Institute where the theory developed) against the evil of Germany, the tubs full of eyeballs, the raping of nuns, the shooting down of parachuting flyers, the air-dropping of poisoned candy. . . It happened with Iraq, Iran, Libya, Syria, Venezuela, China, Russia, North Korea, Brazil, Cuba, Vietnam, Jugoslavia, Serbia, Nicaragua, Haiti (even), and so many more. Then, after you are taught to hate them sufficiently, your government kills them and you believe you have made the world safe for democracy when you were really just being propagandised and used.

    The propaganda is so effective that even after all the lies are revealed, you still cling to your conviction of moral superiority, of having done “good”.

    All you need do is read the ignorant and despicably hateful comments on this article and others similar, to realise the deep effect of this propaganda. One poster believes the Chinese government would happily unleash this virus just to cull their own population.

    290. anon[274] • Disclaimer said: “PRC is … on lockdown because you slopeheads refuse to stop eating tiger dicks, chicken lips and putting live bats up your asses. I hope you ching chongs keep eating bats and wolves, and dogs and cats and get more diseases. The less of you barbaric insects on the planet the better.” It doesn’t matter that he’s a troll. The mere fact that a human being would write such trash tells you how badly infected he is with something more deadly than a virus.

    These people weren’t born that stupid; they were taught by CNN, Fox News, the NYT, WSJ, WP, to become so racist that peoples of other nations, well, “they’re not really human. You know?”

    And that is the real value of ‘freedom of speech’ – so long as you’re the one who controls the microphone.

    • Agree: utu, bluedog, Chinaman, Parfois1
    • Thanks: d dan
  400. denk says:

    I was saying that after [[[the bastards]]] attacked the livestocks , next may come the food crops….

    Then truthseeker 207 reminds me it has already started…

    ‘.
    Army worms have mysteriously appeared in China to decimate crops and chinese agriculture some of them targeted crops specifically in the trade war.

    And now.
    LOcust in China/Pakistan, devouring everything in its path.

  401. Surely something to ponder on. The story does make sense. Difficult to prove but time will tell.

  402. @Anon

    Well, that’s some interesting speculation about various political topics, I’m sure.

    Leaving that aside for a moment, and returning to one of the topics at which OP has chosen to spew his incoherent feelz — epidemiology and virology — this might be slightly more pertinent:

    The Proximal Origin of SARS-CoV-2

  403. @Anon

    Zerohedge hysteria

    They’re sourcing a lot of their coronavirus stories direct from Radio Free Asia, which isinteresting.

  404. Ber says:
    @denk

    Locusts? There is a documentary from CCTV I believe showing how chickens as well as ducks are perfect natural counter against locusts. Apparently a chicken can eat as many as 100 locusts per day.

    • Replies: @denk
  405. @Ayatollah Smith

    I definitely wouldn’t like to see a war but if these viruses (real or hoax, or manufactured by whoever, including more from Africa, India, etc.) lead to a cessation of travel and stricter border controls, I think that’d be great. Everyone goes back to their own countries and looks after their own affairs. We now have the internet technology and can communicate with each other easily without having to see each other. What would be so wrong with that? It seems only the globalists and their pet immigrants they use to destroy sovereign nation states would complain. Tourists can travel inside their own countries instead and every nation becomes more self reliant.

    • Replies: @NPleeze
  406. Ber says:
    @thetruth

    A novel “The Eyes of Darkness” by Kootz, Dean 1981…wrote…nay, predicted the virus some 40 years ago. Some claim it is Russian virus and not Wuhan…etc

    “… a Chinese scientist named Li Chen defected to the Unitied States, carrying a diskette record of China’s most important and dangerous new biological weapon in a decade. They call the stuff “Wuhan-400” because it was developed at their RDNA labs outside of the city of Wuhan, and it was the four-hundreth viable strain of man-made microorganisms created at that research center.

    Wuhan-400 is a perfect weapon. It afflicts only human beings. No other living creature can carry it. And like syphilis, Wuhan-400 can’t survive outside a living human body for longer than a minute, which means it can’t permanently contaminate objects or entire places the way anthrax and other virulent microorganisms can. And when the host expires, the Wuhan-400 within him perished a short while later, as soon as the temperature of the corpse drops below eighty-six Fahrenheit. Do you see advantage of all this?

    …..And Wuhan-400 has other, equally important advantages over biological agents. For one thing, you can become an infectious carrier only four hours after coming into contact with the virus. That’s an incredibly short incubation period.Once infected, no one lives more than twenty-four hours. Most die in twelve. It’s worse than the Ebola virus in Africa – infinitely worse”…..etc.

    https://www.disclose.tv/the-eyes-of-darkness-a-book-from-1981-predicts-wuhan-virus-390139

    “Wuhan 400: Novel predicted coronavirus 40 years ago, Internet stumped”. gulfnews.com. Retrieved 2020-02-18.
    DelhiFebruary 17, India Today Web Desk New; February 17, 2020UPDATED:; Ist, 2020 16:32. “Novel predicted Wuhan virus 40 years before Coronavirus outbreak. Internet is stumped”. India Today. Retrieved 2020-02-18.
    “Did a Chinese Novel Predict Coronavirus 40 Years Ago? ‘Wuhan-400’ Leaves Twitter Baffled”. News18. 2020-02-17. Retrieved 2020-02-18.
    “Wuhan virus in 1981 Dean Koontz novel a coronavirus coincidence”. South China Morning Post. 2020-02-13. Retrieved 2020-02-18

  407. utu says:
    @Commentator Mike

    I hope and found on that “they’re far more subtle”. But you are right that here is a possibility of not sanctioned by the CCP revenge so I think the CCP will do everything to have it under control at the same time also fearing that a revenge will be engineered anyway as false flag by, say, the CIA.

  408. @Ber

    That was potentially a good article, but “a bit long” is too charitable.
    “Rambling” is a fair enough take, aside from the plagiarism.
    It seems nobody really wants to pay editors….

  409. denk says:

    For all those sobs who cry
    ‘this is a Chinese FF to cull population’

    China implemented a one child rule to curb population growth, but ditched it in 2017 to correct a demographic imbalance.

    Now look into the mirror…..

    Who want to cull the useless eaters in the third world….by whatever mean ?

    ——————–

    Nobel Prize-winning Australian microbiologist Sir Macfarlane Burnet secretly